Overview

  • Product name

  • Description

    Rabbit polyclonal to MRI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MRI aa 48-154.
    Sequence:

    PATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCS VSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDV LKYVREI


    Database link: Q9BWK5-1

  • Positive control

    • IHC-P: Human esophagus tissue. WB: MRI overexpression HEK-293T lysate. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab246926 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB Use a concentration of 0.4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • PFA fixed, Triton X-100 permeabilized U-251 MG (Human brain glioma cell line) cells labeling MRI using ab246926 at 4 µg/ml (green) in ICC/IF.

  • Paraffin-embedded human esophagus tissue stained for MRI using ab246926 at 1/50 dilution in immunohistochemical analysis.
  • All lanes : Anti-MRI antibody (ab246926) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : MRI overexpression HEK-293T lysate

References

ab246926 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246926.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up