Overview

  • Product name
    Anti-MRP1 antibody [MRPm5]
    See all MRP1 primary antibodies
  • Description
    Mouse monoclonal [MRPm5] to MRP1
  • Host species
    Mouse
  • Specificity
    MRPm5 does not cross-react with the human MDR1 and MDR3 gene products.
  • Tested applications
    Suitable for: IHC-Fr, IHC-P, Flow Cyt, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human MRP1 aa 986-1204.
    Sequence:

    HVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSM AVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDS MIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVA SSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDEN QKAYYPSIVANRWLAVRLE


    Database link: P33527

  • Epitope
    MRP1 antibody reacts with an internal epitope of MRP1.
  • Positive control
    • Flow Cyt: HL-60 cells. ICC/IF: Human ES cell derived hepatocytes.

Properties

Applications

Our Abpromise guarantee covers the use of ab24102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr 1/20.
IHC-P 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Perform heat mediated antigen retrieval in citrate buffer (pH 6.0) for 10 minutes before commencing with IHC staining protocol.

Flow Cyt 1/20 - 1/50.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

ICC/IF 1/20 - 1/50.
WB 1/20 - 1/50. Predicted molecular weight: 190 kDa.

Target

  • Function
    Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency.
  • Tissue specificity
    Lung, testis and peripheral blood mononuclear cells.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ABC 29 antibody
    • ABC29 antibody
    • ABCC 1 antibody
    • ABCC antibody
    • Abcc1 antibody
    • ATP binding cassette sub family C (CFTR/MRP) member 1 antibody
    • ATP binding cassette sub-family C member 1 antibody
    • ATP binding cassette subfamily C member 1 antibody
    • ATP binding cassette transporter variant ABCC1delta ex13 antibody
    • ATP binding cassette transporter variant ABCC1delta ex13&14 antibody
    • ATP binding cassette transporter variant ABCC1delta ex25 antibody
    • ATP binding cassette transporter variant ABCC1delta ex25&26 antibody
    • ATP binding cassette, sub-family C (CFTR/MRP), member 1 antibody
    • ATP-binding cassette sub-family C member 1 antibody
    • DKFZp686N04233 antibody
    • DKFZp781G125 antibody
    • GS X antibody
    • GSX antibody
    • Leukotriene C(4) transporter antibody
    • LTC4 transporter antibody
    • MRP 1 antibody
    • MRP antibody
    • MRP1 antibody
    • MRP1_HUMAN antibody
    • Multidrug resistance associated protein 1 antibody
    • Multidrug resistance protein antibody
    • Multidrug resistance-associated protein 1 antibody
    • Multiple drug resistance associated protein antibody
    • Multiple drug resistance protein 1 antibody
    see all

Images

  • ICC/IF image of Anti-MRP1 antibody (ab24102) stained human ES cell derived hepatocytes. The cells were fixed in methanol, blocked and permeabilized using 10% BSA in PBS/0.1% Tween, for 1 hour at 20oC. The cells were then incubated with ab24102 at a 1/50 dilution for 16 hours at 4oC. The secondary antibody was a Donkey anti-Mouse Alexa Fluor 488, used at a 1/400 dilution.

    See Abreview

  • Overlay histogram showing HL60 cells stained with ab24102 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab24102, 0.5µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.

References

This product has been referenced in:
  • Tong WY  et al. Delivery of siRNA in vitro and in vivo using PEI-capped porous silicon nanoparticles to silence MRP1 and inhibit proliferation in glioblastoma. J Nanobiotechnology 16:38 (2018). Read more (PubMed: 29653579) »
  • Untereiner AA  et al. Drug resistance induces the upregulation of H2S-producing enzymes in HCT116 colon cancer cells. Biochem Pharmacol 149:174-185 (2018). WB . Read more (PubMed: 29061341) »
See all 20 Publications for this product

Customer reviews and Q&As

1-10 of 10 Abreviews or Q&A

Question
Answer

I'm assuming you're referring to a lysis buffer for sample preparation prior to western blot. If this is the case, since MRP1 is a membrane bound protein we recommend using RIPA buffer for lysis. Our 10X RIPA buffer ab156034 is through the link below:

https://www.abcam.com/10x-ripa-buffer-ab156034.html

Our sample preparation guide below is helpful if you have lysis buffer questions for other protein targets:

https://www.abcam.com/index.html?pageconfig=resource&rid=11379

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C
Sample
Human Cell (ES - derived hepatocytes)
Specification
ES - derived hepatocytes
Permeabilization
Yes - During blocking step, BSA is diluted in PBS/0.1% Tween.
Fixative
Methanol

Abcam user community

Verified customer

Submitted Aug 23 2013

Answer

Thank you for contacting us.

I do hope the suggestions made today shed some light upon the issue you are experiencing with ab24102 Anti-MRP1 antibody [MRPm5] and look forward to hear the results.

This product is covered by our Abpromise guarantee. If we cannot remedy this issue and this is a product that you have purchased within the last six months, we will replace or refund it under our Abpromise guarantee, as you are using it according to specifications listed on our datasheet.

I have found some additional information about large protein transfer which may also be of help to you. The following information is from our Western Blot guide and may be found at: https://www.abcam.com/index.html?pageconfig=resource&rid=11404

Note on transfer of large and small proteins
The balance of SDS and methanol in the transfer buffer, protein size, and gel percentage can affect transfer efficiency. The following modifications will encourage efficient transfer.
Large proteins (>100 kD)
For large proteins, transfer out of the gel may be very slow, just as they run slowly within the gel during separation. If blotting a large protein, be sure to run your samples in a low-concentration gel, 8% or less. These will be very fragile, so handle carefully.
Large proteins will tend to precipitate in the gel, hindering transfer. Adding SDS to a final concentration of 0.1% in the transfer buffer will discourage this. Methanol tends to remove SDS from proteins, so reducing the methanol percentage to 10% or less will also guard against precipitation.
Lowering methanol in the transfer buffer also promotes swelling of the gel, allowing large proteins to transfer more easily.
Methanol is only necessary if using nitrocellulose. If using PVDF, methanol can be removed from the transfer buffer altogether, and is only needed to activate the PVDF before assembling the gel/membrane sandwich.
Choose wet transfer overnight at 4°C instead of semi-dry transfer.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.



Use our products? Submit an Abreview. Earn rewards!

https://www.abcam.com/abreviews

Read More

Answer

Thank you for your inquiry. I am happy to confirm that all these products are suitable for WB and tested and guaranteed.
I suggest ab29889 (Liver (Human) Tissue Lysate - adult normal tissue) as positive control for ab3366, ab3373, ab3375 and ab24102.
https://www.abcam.com/index.html?datasheet=29889 https://www.abcam.com/index.html?datasheet=29889.
MRP4 is barely detectable in liver and therefore I recommend to use ab30304 (Prostate (Human) Tissue Lysate - adult normal tissue) as positive control.
https://www.abcam.com/index.html?datasheet=30304 https://www.abcam.com/index.html?datasheet=30304.
With ab63907 we used ab29745 (Placenta (Human) Tissue Lysate - adult normal tissue) successfully as control.
https://www.abcam.com/index.html?datasheet=29745 https://www.abcam.com/index.html?datasheet=29745.
I hope this information is helpful and wish you good luck with your research.

Read More

Answer

Thank you for your enquiry and your interest in our products.

Here are a few antibodies against the following targets which have been tested and characterized for Flow cytometry. Please take a look at the on-line datasheets for further information about tested species/application/purity/concentration.

P-gp (MDR1)



ab3366: https://www.abcam.com/P-Glycoprotein-antibody-JSB-1-ab3366.html

ab3083: https://www.abcam.com/P-Glycoprotein-antibody-265-F4-ab3083.html

ab80594:https://www.abcam.com/P-Glycoprotein-antibody-F4-BSA-and-Azide-free-ab80594.html



MRP1:



ab24102: https://www.abcam.com/MRP1-antibody-MRPm5-ab24102.html



BCRP:



ab24115: https://www.abcam.com/BCRPABCG2-antibody-BXP-53-ab24115.html



If you need any further assistance in the future, please do not hesitate to contact me.

Read More

Answer

Thank you for contacting us. We do have products that are conjugated to match your needs, Ab81424 Anti-CD44 antibody [MEM-263] is conjugated with APC. Ab58754 Anti-CD44 antibody [MEM-263] (Phycoerythrin). I've included links to each below: https://www.abcam.com/CD44-antibody-MEM-263-Allophycocyanin-ab81424.html https://www.abcam.com/CD44-antibody-MEM-263-Phycoerythrin-Extracellular-domain-ab58754.html I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Answer

Thank you for contacting Abcam. We offer a number of PGP antibodies that are guaranteed to work in Flow Cytometry on dog cells. I would recommend https://www.abcam.com/CD44-antibody-IM7-ab119863.htmlor the FITC conjugated https://www.abcam.com/CD44-antibody-IM7-FITC-ab19622.htmlantibodies. I've pasted the link to the search results below: https://www.abcam.com/index.html?pageconfig=searchresults If you also require a MRP1 antibody that works in Flow Cytometry we offer ab24102 Anti-MRP1 antibody [MRPm5] ( https://www.abcam.com/MRP1-antibody-MRPm5-ab24102.html). This has not yet been tested in dog and would not therefore to covered by our Abpromise. However, because of the high homology between the dog protein and human protein that this was derived from we can offer you an Abreview discount. Under this plan if you buy ab24102 now, test it indog and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free PRIMARY ANTIBODY. If you are interested in this offer, please follow these steps: 1. Reply to this e-mail to let me know that you would like to proceed and test ab24102 in dog. I will then send a discount code. This code must be issued before purchasing ab24102 so please wait for my reply before ordering. 2. Purchase ab24105 either by phone, fax, or online (www.abcam.com). 3. Test it in dog. 4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews. 5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any PRIMARY ANTIBODY ordered and the discount code is valid for 4 months after issue. We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab24102 turns out to be unsuitable for dog, you will still receive the discount on your next purchase after your Abreview has been submitted. Please let me know if you have any questions about this offer and I would be happy to help you further. The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Answer

Thank you for contacting us. ab3364; anti P Glycoprotein is no longer available in our catalogue. However we have similar products available to buy. The catalogue numbers are ab3083; ab3366; ab10333; ab80594; ab80626. Please check the datasheets of these antibodies and select a product according to your requirements. The anti MDR2 products are ab71792; ab24108 and ab111209 Anti MRP1 products are ab24102; ab63987; ab99531; ab81903 To search different products please type target name in the search box provided on the Abcam homepage at www.abcam.com. After hitting the search button the system will give you the sorted product as per your target request. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More
Abcam has not validated the combination of species/application used in this Abreview.
Application
Western blot
Sample
Rat Cell lysate - whole cell (Liver)
Gel Running Conditions
Reduced Denaturing (Samples were not denatured prior to gel loading)
Loading amount
80 µg
Specification
Liver
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 27°C

Abcam user community

Verified customer

Submitted Feb 14 2011

Question
Answer

The only recommendation I have seen for a western blot positive control is a lysate from cells transfected with MRP1. We do not have such a lysate or a recombinant protein. As I mentioned in our phone call, endogenous sources include lung, testis, and peripheral mononuclear cells. I searched the literature for a cell line that might be a suitable positive control (we have many lysates) and found this article: Cloning and Characterization of the Murine and Rat mrp1 Promoter Regions Mol Pharmacol. 2003 Nov;64(5):1259-69. which mentions HL60/ADR and H69AR, which we do not have. The article may suggest other potential candidates. I hope this helps. If you have any other questions, please do not hesitate to contact us.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up