Anti-MRP1 antibody [MRPm5] (ab24102)
Key features and details
- Mouse monoclonal [MRPm5] to MRP1
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-MRP1 antibody [MRPm5]
See all MRP1 primary antibodies -
Description
Mouse monoclonal [MRPm5] to MRP1 -
Host species
Mouse -
Specificity
MRPm5 reacts with an internal epitope of MRP1, a 180-195 kD transmembrane transporter protein overexpressed in various
human non-P-glycoprotein MDR tumor cell lines.MRPm5 does not cross-react with the human MDR1 and MDR3 gene products.
-
Species reactivity
Reacts with: Human -
Immunogen
Fusion protein corresponding to Human MRP1 aa 986-1204.
Sequence:HVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSM AVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDS MIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVA SSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDEN QKAYYPSIVANRWLAVRLE
Database link: P33527 -
Epitope
MRP1 antibody reacts with an internal epitope of MRP1. -
Positive control
- ICC/IF: Human ES cell derived hepatocytes.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: 0.1% BSA, PBS
Serum free tissue culture supernatant -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
MRPm5 -
Myeloma
Sp2/0 -
Isotype
IgG2a -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Target
-
Function
Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency. -
Tissue specificity
Lung, testis and peripheral blood mononuclear cells. -
Sequence similarities
Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
Contains 2 ABC transmembrane type-1 domains.
Contains 2 ABC transporter domains. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 4363 Human
- Omim: 158343 Human
- SwissProt: P33527 Human
- Unigene: 391464 Human
-
Alternative names
- ABC 29 antibody
- ABC29 antibody
- ABCC 1 antibody
see all
Protocols
References (38)
ab24102 has been referenced in 38 publications.
- Pillai-Kastoori L et al. Antibody validation for Western blot: By the user, for the user. J Biol Chem 295:926-939 (2020). PubMed: 31819006
- Zhang X et al. ID4 Promotes Breast Cancer Chemotherapy Resistance via CBF1-MRP1 Pathway. J Cancer 11:3846-3857 (2020). PubMed: 32328189
- Li JM et al. Dehydrogenase/reductase SDR family member 2 silencing sensitizes an oxaliplatin-resistant cell line to oxaliplatin by inhibiting excision repair cross-complementing group 1 protein expression. Oncol Rep 42:1725-1734 (2019). PubMed: 31436301
- Ji L et al. PIDD interaction with KEAP1 as a new mutation-independent mechanism to promote NRF2 stabilization and chemoresistance in NSCLC. Sci Rep 9:12437 (2019). PubMed: 31455821
- Koehn LM et al. Developmental differences in the expression of ABC transporters at rat brain barrier interfaces following chronic exposure to diallyl sulfide. Sci Rep 9:5998 (2019). PubMed: 30979952