Overview

  • Product name
    Anti-MRP1 antibody [MRPm5]
    See all MRP1 primary antibodies
  • Description
    Mouse monoclonal [MRPm5] to MRP1
  • Host species
    Mouse
  • Specificity
    MRPm5 does not cross-react with the human MDR1 and MDR3 gene products.
  • Tested applications
    Suitable for: IHC-Fr, IHC-P, Flow Cyt, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human MRP1 aa 986-1204.
    Sequence:

    HVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSM AVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDS MIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVA SSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDEN QKAYYPSIVANRWLAVRLE


    Database link: P33527

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Epitope
    MRP1 antibody reacts with an internal epitope of MRP1.
  • Positive control
    • Flow Cyt: HL-60 cells. ICC/IF: Human ES cell derived hepatocytes.

Properties

Applications

Our Abpromise guarantee covers the use of ab24102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr 1/20.
IHC-P 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Perform heat mediated antigen retrieval in citrate buffer (pH 6.0) for 10 minutes before commencing with IHC staining protocol.
Flow Cyt 1/20 - 1/50.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 
ICC/IF 1/20 - 1/50.
WB 1/20 - 1/50. Predicted molecular weight: 190 kDa.

Target

  • Function
    Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency.
  • Tissue specificity
    Lung, testis and peripheral blood mononuclear cells.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
    • Alternative names
      • ABC 29 antibody
      • ABC29 antibody
      • ABCC 1 antibody
      • ABCC antibody
      • Abcc1 antibody
      • ATP binding cassette sub family C (CFTR/MRP) member 1 antibody
      • ATP binding cassette sub-family C member 1 antibody
      • ATP binding cassette subfamily C member 1 antibody
      • ATP binding cassette transporter variant ABCC1delta ex13 antibody
      • ATP binding cassette transporter variant ABCC1delta ex13&14 antibody
      • ATP binding cassette transporter variant ABCC1delta ex25 antibody
      • ATP binding cassette transporter variant ABCC1delta ex25&26 antibody
      • ATP binding cassette, sub-family C (CFTR/MRP), member 1 antibody
      • ATP-binding cassette sub-family C member 1 antibody
      • DKFZp686N04233 antibody
      • DKFZp781G125 antibody
      • GS X antibody
      • GSX antibody
      • Leukotriene C(4) transporter antibody
      • LTC4 transporter antibody
      • MRP 1 antibody
      • MRP antibody
      • MRP1 antibody
      • MRP1_HUMAN antibody
      • Multidrug resistance associated protein 1 antibody
      • Multidrug resistance protein antibody
      • Multidrug resistance-associated protein 1 antibody
      • Multiple drug resistance associated protein antibody
      • Multiple drug resistance protein 1 antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-MRP1 antibody [MRPm5] (ab24102)
      Immunocytochemistry/ Immunofluorescence - Anti-MRP1 antibody [MRPm5] (ab24102)This image is courtesy of an anonymous abreview.

      ICC/IF image of Anti-MRP1 antibody (ab24102) stained human ES cell derived hepatocytes. The cells were fixed in methanol, blocked and permeabilized using 10% BSA in PBS/0.1% Tween, for 1 hour at 20oC. The cells were then incubated with ab24102 at a 1/50 dilution for 16 hours at 4oC. The secondary antibody was a Donkey anti-Mouse Alexa Fluor 488, used at a 1/400 dilution.

      See Abreview

    • Flow Cytometry - Anti-MRP1 antibody [MRPm5] (ab24102)
      Flow Cytometry - Anti-MRP1 antibody [MRPm5] (ab24102)
      Overlay histogram showing HL60 cells stained with ab24102 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab24102, 0.5µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.

    References

    This product has been referenced in:
    • Tong WY  et al. Delivery of siRNA in vitro and in vivo using PEI-capped porous silicon nanoparticles to silence MRP1 and inhibit proliferation in glioblastoma. J Nanobiotechnology 16:38 (2018). Read more (PubMed: 29653579) »
    • Untereiner AA  et al. Drug resistance induces the upregulation of H2S-producing enzymes in HCT116 colon cancer cells. Biochem Pharmacol 149:174-185 (2018). WB . Read more (PubMed: 29061341) »

    See all 19 Publications for this product

    Publishing research using ab24102? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Submit a review Submit a question

    10 reviews or Q&A

    10
    Votes: Highest First

    What lysis buffer gives the best result to study MRP1 with the MRPm5 antibody?

    I'm assuming you're referring to a lysis buffer for sample preparation prior to western blot. If this is the case, since MRP1 is a membrane bound protein we recommend using RIPA buffer for lysis. Our 10X RIPA buffer ab156034 is through the link below:<...

    Read More

    Immunocytochemistry/ Immunofluorescence abreview for Anti-MRP1 antibody [MRPm5]

     Excellent
    Abreviews
    Abcam guarantees this product to work in the species/application used in this Abreview.
    Application
    Immunocytochemistry/ Immunofluorescence
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C
    Sample
    Human Cell (ES - derived hepatocytes)
    Specification
    ES - derived hepatocytes
    Permeabilization
    Yes - During blocking step, BSA is diluted in PBS/0.1% Tween.
    Fixative
    Methanol
    Read More
    abreview image
    Username

    Abcam user community

    Verified customer

    Submitted Aug 23 2013

    Customer kindly contacted us as they are experiencing issues when using ab24102 Anti-MRP1 antibody [MRPm5] in WB on human samples.

    Thank you for contacting us.

    I do hope the suggestions made today shed some light upon the issue you are experiencing with ab24102 Anti-MRP1 antibody [MRPm5] and look forward to hear the results.

    This product is covered by our Abpro...

    Read More

    To technical support,



    I would like to order a complete set of antibodies and controls from Abcam for WB analysis. Could you check if these antibodies would suit for the analysis. In addition, could you recommend some positive con...

    Read More

    Thank you for your inquiry. I am happy to confirm that all these products are suitable for WB and tested and guaranteed.
    I suggest ab29889 (Liver (Human) Tissue Lysate - adult normal tissue) as positive control for ab3366, ab3373, ab3375 and ab241...

    Read More

    Please can you supply antibody that could be used for Flow cytometry detection of any of these markers - MDR1, MRP1 and BCRP, and that would have concentration of at least 1 mg/ml.

    thank you very much

    best regards

    Thank you for your enquiry and your interest in our products.

    Here are a few antibodies against the following targets which have been tested and characterized for Flow cytometry. Please take a look at the on-line datasheets for further inform...

    Read More

    Thank you very much for your reply. I have one problem that we are looking for antibody in addition to those already mentioned conditions can not be conjugated with FITC. It should be conjugated with APC, PerCP, or PE. Do you have a suitable I will be ...

    Read More

    Thank you for contacting us. We do have products that are conjugated to match your needs, Ab81424 Anti-CD44 antibody [MEM-263] is conjugated with APC. Ab58754 Anti-CD44 antibody [MEM-263] (Phycoerythrin). I've included links to each below: https://www....

    Read More

    We are interested in finding antibodies for P-glycoprotein PGP want this to be useful for working with Flow Cytometry for dog cancer cells. Could you recommend us thou hast? or CD44 antibodies did not show us both PGP and MRP1? We will be grateful for ...

    Read More

    Thank you for contacting Abcam. We offer a number of PGP antibodies that are guaranteed to work in Flow Cytometry on dog cells. I would recommend https://www.abcam.com/CD44-antibody-IM7-ab119863.htmlor the FITC conjugated https://www.abcam.com/CD44-ant...

    Read More

    Dear Sir/Madam, I was recently reading an article which uses one of your antibodies. I cannot seem to locate this product on your website and was wondering if you could point me in the right direction. The article states using: "a mouse-monoclona...

    Read More

    Thank you for contacting us. ab3364; anti P Glycoprotein is no longer available in our catalogue. However we have similar products available to buy. The catalogue numbers are ab3083; ab3366; ab10333; ab80594; ab80626. Please check the da...

    Read More

    Western blot abreview for Anti-MRP1 antibody [MRPm5]

     Excellent
    Abreviews
    Abcam has not validated the combination of species/application used in this Abreview.
    Application
    Western blot
    Sample
    Rat Cell lysate - whole cell (Liver)
    Gel Running Conditions
    Reduced Denaturing (Samples were not denatured prior to gel loading)
    Loading amount
    80 µg
    Specification
    Liver
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 27°C
    Read More
    abreview image
    Username

    Abcam user community

    Verified customer

    Submitted Feb 14 2011

    Please recommend a positive control for western blotting.

    The only recommendation I have seen for a western blot positive control is a lysate from cells transfected with MRP1. We do not have such a lysate or a recombinant protein. As I mentioned in our phone call, endogenous sources include lung, testis, and ...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up