For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    mrp1-antibody-mrpm5-ab24102.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Plasma Membrane Channels
Share by email

Anti-MRP1 antibody [MRPm5] (ab24102)

  • Datasheet
  • SDS
Reviews (3)Q&A (8)References (38)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Mouse monoclonal [MRPm5] to MRP1
  • Reacts with: Human
  • Isotype: IgG2a

You may also be interested in

Assay
Product image
Peroxidase Activity Assay Kit (ab155895)
Primary
Product image
Anti-P Glycoprotein antibody [EPR10363] (ab170903)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-MRP1 antibody [MRPm5]
    See all MRP1 primary antibodies
  • Description

    Mouse monoclonal [MRPm5] to MRP1
  • Host species

    Mouse
  • Specificity

    MRPm5 reacts with an internal epitope of MRP1, a 180-195 kD transmembrane transporter protein overexpressed in various
    human non-P-glycoprotein MDR tumor cell lines.

    MRPm5 does not cross-react with the human MDR1 and MDR3 gene products.

  • Species reactivity

    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human MRP1 aa 986-1204.
    Sequence:

    HVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSM AVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDS MIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVA SSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDEN QKAYYPSIVANRWLAVRLE


    Database link: P33527
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Epitope

    MRP1 antibody reacts with an internal epitope of MRP1.
  • Positive control

    • ICC/IF: Human ES cell derived hepatocytes.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 0.1% BSA, PBS

    Serum free tissue culture supernatant
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Clone number

    MRPm5
  • Myeloma

    Sp2/0
  • Isotype

    IgG2a
  • Research areas

    • Signal Transduction
    • Metabolism
    • Plasma Membrane
    • Channels
    • Signal Transduction
    • Metabolism
    • Drug metabolism
    • Cancer
    • Drug resistance
    • MRP-related proteins
    • Cardiovascular
    • Atherosclerosis
    • Hypertension
    • Sodium/ion transport
    • Cardiovascular
    • Blood
    • Blood Pressure regulation
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Hormone biosynthesis
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Drug metabolism
    • Metabolism
    • Pathways and Processes
    • Endocrine metabolism
    • Hormone biosynthesis
    • Metabolism
    • Types of disease
    • Cancer
    • Metabolism
    • Types of disease
    • Heart disease

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Goat Anti-Mouse IgG H&L (DyLight® 488) preadsorbed (ab96879)
  • Isotype control

    • Mouse IgG2a, kappa monoclonal [MG2a-53] - Isotype control (ab18415)
  • Recombinant Protein

    • Recombinant Human MRP1 protein (His tag) (ab235016)

Target

  • Function

    Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency.
  • Tissue specificity

    Lung, testis and peripheral blood mononuclear cells.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Cell membrane.
  • Target information above from: UniProt accession P33527 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 4363 Human
    • Omim: 158343 Human
    • SwissProt: P33527 Human
    • Unigene: 391464 Human
    • Alternative names

      • ABC 29 antibody
      • ABC29 antibody
      • ABCC 1 antibody
      • ABCC antibody
      • Abcc1 antibody
      • ATP binding cassette sub family C (CFTR/MRP) member 1 antibody
      • ATP binding cassette sub-family C member 1 antibody
      • ATP binding cassette subfamily C member 1 antibody
      • ATP binding cassette transporter variant ABCC1delta ex13 antibody
      • ATP binding cassette transporter variant ABCC1delta ex13&14 antibody
      • ATP binding cassette transporter variant ABCC1delta ex25 antibody
      • ATP binding cassette transporter variant ABCC1delta ex25&26 antibody
      • ATP binding cassette, sub-family C (CFTR/MRP), member 1 antibody
      • ATP-binding cassette sub-family C member 1 antibody
      • DKFZp686N04233 antibody
      • DKFZp781G125 antibody
      • GS X antibody
      • GSX antibody
      • Leukotriene C(4) transporter antibody
      • LTC4 transporter antibody
      • MRP 1 antibody
      • MRP antibody
      • MRP1 antibody
      • MRP1_HUMAN antibody
      • Multidrug resistance associated protein 1 antibody
      • Multidrug resistance protein antibody
      • Multidrug resistance-associated protein 1 antibody
      • Multiple drug resistance associated protein antibody
      • Multiple drug resistance protein 1 antibody
      see all

    Protocols

    • Flow cytometry protocols
    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (38)

    Publishing research using ab24102? Please let us know so that we can cite the reference in this datasheet.

    ab24102 has been referenced in 38 publications.

    • Pillai-Kastoori L  et al. Antibody validation for Western blot: By the user, for the user. J Biol Chem 295:926-939 (2020). PubMed: 31819006
    • Zhang X  et al. ID4 Promotes Breast Cancer Chemotherapy Resistance via CBF1-MRP1 Pathway. J Cancer 11:3846-3857 (2020). PubMed: 32328189
    • Li JM  et al. Dehydrogenase/reductase SDR family member 2 silencing sensitizes an oxaliplatin-resistant cell line to oxaliplatin by inhibiting excision repair cross-complementing group 1 protein expression. Oncol Rep 42:1725-1734 (2019). PubMed: 31436301
    • Ji L  et al. PIDD interaction with KEAP1 as a new mutation-independent mechanism to promote NRF2 stabilization and chemoresistance in NSCLC. Sci Rep 9:12437 (2019). PubMed: 31455821
    • Koehn LM  et al. Developmental differences in the expression of ABC transporters at rat brain barrier interfaces following chronic exposure to diallyl sulfide. Sci Rep 9:5998 (2019). PubMed: 30979952
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-10 of 11 Abreviews or Q&A

    Western blot abreview for Anti-MRP1 antibody [MRPm5]

    Average
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Pig Cell lysate - whole cell (Testis)
    Gel Running Conditions
    Reduced Non-Denaturing (Native) (8%)
    Loading amount
    40 µg
    Specification
    Testis
    Blocking step
    Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 0.1% · Temperature: 23°C
    Read More

    Dorothy Elsken

    Verified customer

    Submitted Jul 22 2019

    Question

    What lysis buffer gives the best result to study MRP1 with the MRPm5 antibody?

    Read More

    Abcam community

    Verified customer

    Asked on Feb 25 2014

    Answer

    I'm assuming you're referring to a lysis buffer for sample preparation prior to western blot. If this is the case, since MRP1 is a membrane bound protein we recommend using RIPA buffer for lysis. Our 10X RIPA buffer ab156034 is through the link below:

    https://www.abcam.com/10x-ripa-buffer-ab156034.html

    Our sample preparation guide below is helpful if you have lysis buffer questions for other protein targets:

    https://www.abcam.com/index.html?pageconfig=resource&rid=11379

    Read More

    Kevin Hanson

    Abcam Scientific Support

    Answered on Feb 25 2014

    Immunocytochemistry/ Immunofluorescence abreview for Anti-MRP1 antibody [MRPm5]

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C
    Sample
    Human Cell (ES - derived hepatocytes)
    Specification
    ES - derived hepatocytes
    Permeabilization
    Yes - During blocking step, BSA is diluted in PBS/0.1% Tween.
    Fixative
    Methanol
    Read More

    Abcam user community

    Verified customer

    Submitted Aug 23 2013

    Question

    Customer kindly contacted us as they are experiencing issues when using ab24102 Anti-MRP1 antibody [MRPm5] in WB on human samples.

    Read More

    Abcam community

    Verified customer

    Asked on Sep 07 2012

    Answer

    Thank you for contacting us.

    I do hope the suggestions made today shed some light upon the issue you are experiencing with ab24102 Anti-MRP1 antibody [MRPm5] and look forward to hear the results.

    This product is covered by our Abpromise guarantee. If we cannot remedy this issue and this is a product that you have purchased within the last six months, we will replace or refund it under our Abpromise guarantee, as you are using it according to specifications listed on our datasheet.

    I have found some additional information about large protein transfer which may also be of help to you. The following information is from our Western Blot guide and may be found at: https://www.abcam.com/index.html?pageconfig=resource&rid=11404

    Note on transfer of large and small proteins
    The balance of SDS and methanol in the transfer buffer, protein size, and gel percentage can affect transfer efficiency. The following modifications will encourage efficient transfer.
    Large proteins (>100 kD)
    For large proteins, transfer out of the gel may be very slow, just as they run slowly within the gel during separation. If blotting a large protein, be sure to run your samples in a low-concentration gel, 8% or less. These will be very fragile, so handle carefully.
    Large proteins will tend to precipitate in the gel, hindering transfer. Adding SDS to a final concentration of 0.1% in the transfer buffer will discourage this. Methanol tends to remove SDS from proteins, so reducing the methanol percentage to 10% or less will also guard against precipitation.
    Lowering methanol in the transfer buffer also promotes swelling of the gel, allowing large proteins to transfer more easily.
    Methanol is only necessary if using nitrocellulose. If using PVDF, methanol can be removed from the transfer buffer altogether, and is only needed to activate the PVDF before assembling the gel/membrane sandwich.
    Choose wet transfer overnight at 4°C instead of semi-dry transfer.

    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.



    Use our products? Submit an Abreview. Earn rewards!

    https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on Sep 07 2012

    Question

    To technical support,



    I would like to order a complete set of antibodies and controls from Abcam for WB analysis. Could you check if these antibodies would suit for the analysis. In addition, could you recommend some positive controls.







    https://www.abcam.com/P-Glycoprotein-antibody-JSB-1-ab3366.html



    https://www.abcam.com/P-Glycoprotein-antibody-JSB-1-ab3366.html





    https://www.abcam.com/MRP2-antibody-M2-III-6-ab3373.html



    https://www.abcam.com/MRP2-antibody-M2-III-6-ab3373.html





    https://www.abcam.com/MRP3-antibody-M3II-9-ab3375.html



    https://www.abcam.com/MRP3-antibody-M3II-9-ab3375.html





    https://www.abcam.com/MRP1-antibody-MRPm5-ab24102.html



    https://www.abcam.com/MRP1-antibody-MRPm5-ab24102.html





    https://www.abcam.com/BCRPABCG2-antibody-ab63907.html



    https://www.abcam.com/BCRPABCG2-antibody-ab63907.html





    https://www.abcam.com/MRP4-antibody-ab77184.html



    https://www.abcam.com/MRP4-antibody-ab77184.html





    https://www.abcam.com/Goat-Mouse-IgG-HL-Alkaline-Phosphatase-ab97020.html



    https://www.abcam.com/Goat-Mouse-IgG-HL-Alkaline-Phosphatase-ab97020.html





    https://www.abcam.com/Goat-Rabbit-IgG-HL-Alkaline-Phosphatase-ab97048.html



    https://www.abcam.com/Goat-Rabbit-IgG-HL-Alkaline-Phosphatase-ab97048.html





    https://www.abcam.com/Rabbit-Goat-IgG-HL-Alkaline-Phosphatase-ab97097.html



    https://www.abcam.com/Rabbit-Goat-IgG-HL-Alkaline-Phosphatase-ab97097.html





    https://www.abcam.com/NBT--BCIP-Solution-Ready-to-Use-Alkaline-Phosphatase-chromogen-ab7468.html



    https://www.abcam.com/NBT--BCIP-Solution-Ready-to-Use-Alkaline-Phosphatase-chromogen-ab7468.html





    https://www.abcam.com/alpha-Tubulin-antibody-DM1A-Loading-Control-ab7291.html



    https://www.abcam.com/alpha-Tubulin-antibody-DM1A-Loading-Control-ab7291.html







    With kind regards,

    Read More

    Abcam community

    Verified customer

    Asked on Sep 05 2012

    Answer

    Thank you for your inquiry. I am happy to confirm that all these products are suitable for WB and tested and guaranteed.
    I suggest ab29889 (Liver (Human) Tissue Lysate - adult normal tissue) as positive control for ab3366, ab3373, ab3375 and ab24102.
    https://www.abcam.com/Human-liver-tissue-lysate-total-protein-ab29889.html https://www.abcam.com/Human-liver-tissue-lysate-total-protein-ab29889.html.
    MRP4 is barely detectable in liver and therefore I recommend to use ab30304 (Prostate (Human) Tissue Lysate - adult normal tissue) as positive control.
    https://www.abcam.com/Human-prostate-tissue-lysate-total-protein-ab30304.html https://www.abcam.com/Human-prostate-tissue-lysate-total-protein-ab30304.html.
    With ab63907 we used ab29745 (Placenta (Human) Tissue Lysate - adult normal tissue) successfully as control.
    https://www.abcam.com/Human-placenta-tissue-lysate-total-protein-ab29745.html https://www.abcam.com/Human-placenta-tissue-lysate-total-protein-ab29745.html.
    I hope this information is helpful and wish you good luck with your research.

    Read More

    Abcam Scientific Support

    Answered on Sep 05 2012

    Question

    Please can you supply antibody that could be used for Flow cytometry detection of any of these markers - MDR1, MRP1 and BCRP, and that would have concentration of at least 1 mg/ml.

    thank you very much

    best regards

    Read More

    Abcam community

    Verified customer

    Asked on Jul 23 2012

    Answer

    Thank you for your enquiry and your interest in our products.

    Here are a few antibodies against the following targets which have been tested and characterized for Flow cytometry. Please take a look at the on-line datasheets for further information about tested species/application/purity/concentration.

    P-gp (MDR1)



    ab3366: https://www.abcam.com/P-Glycoprotein-antibody-JSB-1-ab3366.html

    ab3083: https://www.abcam.com/P-Glycoprotein-antibody-265-F4-ab3083.html

    ab80594:https://www.abcam.com/P-Glycoprotein-antibody-F4-BSA-and-Azide-free-ab80594.html



    MRP1:



    ab24102: https://www.abcam.com/MRP1-antibody-MRPm5-ab24102.html



    BCRP:



    ab24115: https://www.abcam.com/BCRPABCG2-antibody-BXP-53-ab24115.html



    If you need any further assistance in the future, please do not hesitate to contact me.

    Read More

    Abcam Scientific Support

    Answered on Jul 23 2012

    Question

    Thank you very much for your reply. I have one problem that we are looking for antibody in addition to those already mentioned conditions can not be conjugated with FITC. It should be conjugated with APC, PerCP, or PE. Do you have a suitable I will be grateful for your help

    Read More

    Abcam community

    Verified customer

    Asked on Jan 05 2012

    Answer

    Thank you for contacting us. We do have products that are conjugated to match your needs, Ab81424 Anti-CD44 antibody [MEM-263] is conjugated with APC. Ab58754 Anti-CD44 antibody [MEM-263] (Phycoerythrin). I've included links to each below: https://www.abcam.com/CD44-antibody-MEM-263-Allophycocyanin-ab81424.html https://www.abcam.com/CD44-antibody-MEM-263-Phycoerythrin-Extracellular-domain-ab58754.html I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Jan 05 2012

    Question

    We are interested in finding antibodies for P-glycoprotein PGP want this to be useful for working with Flow Cytometry for dog cancer cells. Could you recommend us thou hast? or CD44 antibodies did not show us both PGP and MRP1? We will be grateful for a hint With Kind Regards

    Read More

    Abcam community

    Verified customer

    Asked on Jan 04 2012

    Answer

    Thank you for contacting Abcam. We offer a number of PGP antibodies that are guaranteed to work in Flow Cytometry on dog cells. I would recommend https://www.abcam.com/CD44-antibody-IM7-ab119863.htmlor the FITC conjugated https://www.abcam.com/CD44-antibody-IM7-FITC-ab19622.htmlantibodies. I've pasted the link to the search results below: https://www.abcam.com/index.html?pageconfig=searchresults If you also require a MRP1 antibody that works in Flow Cytometry we offer ab24102 Anti-MRP1 antibody [MRPm5] ( https://www.abcam.com/MRP1-antibody-MRPm5-ab24102.html). This has not yet been tested in dog and would not therefore to covered by our Abpromise. However, because of the high homology between the dog protein and human protein that this was derived from we can offer you an Abreview discount. Under this plan if you buy ab24102 now, test it indog and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free PRIMARY ANTIBODY. If you are interested in this offer, please follow these steps: 1. Reply to this e-mail to let me know that you would like to proceed and test ab24102 in dog. I will then send a discount code. This code must be issued before purchasing ab24102 so please wait for my reply before ordering. 2. Purchase ab24105 either by phone, fax, or online (www.abcam.com). 3. Test it in dog. 4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews. 5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any PRIMARY ANTIBODY ordered and the discount code is valid for 4 months after issue. We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab24102 turns out to be unsuitable for dog, you will still receive the discount on your next purchase after your Abreview has been submitted. Please let me know if you have any questions about this offer and I would be happy to help you further. The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Jan 04 2012

    Question

    Dear Sir/Madam, I was recently reading an article which uses one of your antibodies. I cannot seem to locate this product on your website and was wondering if you could point me in the right direction. The article states using: "a mouse-monoclonal antibody against mammalian Pgp (C219; Abcam, Cambridge, MA, USA).... This antibody targets two Pgp epitopes that are largely conserved in the SMDR2 sequence" Another issue you may be able to help me with is whether or not you have a primary antibody that would recognise a variety of pgp/mdr proteins (has to include MDR2 (human gene family ABCB1) and MRP1 (human gene family ABCC1)) i.e. it may bind a highly conserved region across the pgps. I would really appreciate any help with the matter as I have been trawling through many of the antibodies available and comparing immunogens. I hope you can help, thank you for your time Kind regards

    Read More

    Abcam community

    Verified customer

    Asked on Sep 16 2011

    Answer

    Thank you for contacting us. ab3364; anti P Glycoprotein is no longer available in our catalogue. However we have similar products available to buy. The catalogue numbers are ab3083; ab3366; ab10333; ab80594; ab80626. Please check the datasheets of these antibodies and select a product according to your requirements. The anti MDR2 products are ab71792; ab24108 and ab111209 Anti MRP1 products are ab24102; ab63987; ab99531; ab81903 To search different products please type target name in the search box provided on the Abcam homepage at www.abcam.com. After hitting the search button the system will give you the sorted product as per your target request. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Sep 16 2011

    Western blot abreview for Anti-MRP1 antibody [MRPm5]

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Rat Cell lysate - whole cell (Liver)
    Gel Running Conditions
    Reduced Denaturing (Samples were not denatured prior to gel loading)
    Loading amount
    80 µg
    Specification
    Liver
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 27°C
    Read More

    Abcam user community

    Verified customer

    Submitted Feb 14 2011

    1-10 of 11 Abreviews or Q&A

    •  Previous
    • 1
    • 2
    • Next 

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.