Overview

  • Product name

  • Description

    Rabbit polyclonal to MRP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human MRP2 aa 483-533 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    KSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKE L


    Database link: Q92887

  • Positive control

    • Human liver carcinoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA

    Aqueous buffered solution
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

WB 1/100 - 1/1000. Predicted molecular weight: 174 kDa.

Target

  • Function

    Mediates hepatobiliary excretion of numerous organic anions. May function as a cellular cisplatin transporter.
  • Tissue specificity

    Found on the apical membrane of polarized cells in liver, kidney and intestine. The highest expression is found in liver.
  • Involvement in disease

    Defects in ABCC2 are the cause of Dubin-Johnson syndrome (DJS) [MIM:237500]. DJS is an autosomal recessive disorder characterized by conjugated hyperbilirubinemia, an increase in the urinary excretion of coproporphyrin isomer I, deposition of melanin-like pigment in hepatocytes, and prolonged retention of sulfobromophthalein, but otherwise normal liver function.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABC30 antibody
    • abcC2 antibody
    • ATP binding cassette sub family C (CFTR/MRP) member 2 antibody
    • ATP binding cassette subfamily C member 2 antibody
    • ATP-binding cassette sub-family C member 2 antibody
    • Canalicular multidrug resistance protein antibody
    • Canalicular multispecific organic anion transporter 1 antibody
    • CMOAT antibody
    • CMOAT1 antibody
    • cMRP antibody
    • DJS antibody
    • KIAA1010 antibody
    • MRP 2 antibody
    • MRP2_HUMAN antibody
    • Multidrug resistance associated protein 2 antibody
    • Multidrug resistance-associated protein 2 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis on human liver carcinoma labeled with ab203397 at 1:200, overnight at 4°C.  The secondary antibody was Goat Anti-Rabbit IgG,PE conjugate used at 1:200 dilution for 40 minutes at 37°C.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis on human liver carcinoma labeled with ab203397 at 1:200 followed by conjugation to secondary antibody and DAB staining.

References

This product has been referenced in:

  • Chen L  et al. Everolimus Reverses Palbociclib Resistance in ER+ Human Breast Cancer Cells by Inhibiting Phosphatidylinositol 3-Kinase(PI3K)/Akt/Mammalian Target of Rapamycin (mTOR) Pathway. Med Sci Monit 25:77-86 (2019). Read more (PubMed: 30605443) »
  • Xiao Y  et al. Quercetin and kaempferol increase the intestinal absorption of isorhamnetin coexisting in Elaeagnus rhamnoides (L.) A. Nelson (Elaeagnaceae) extracts via regulating multidrug resistance-associated protein 2. Phytomedicine 53:154-162 (2019). Read more (PubMed: 30668394) »
See all 9 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up