Overview

  • Product name

  • Description

    Rabbit polyclonal to MRP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MRP3 aa 814-944.
    Sequence:

    FLPQTDFIIVLADGQVSEMGPYPALLQRNGSFANFLCNYAPDEDQGHLED SWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSD GEGQGRPVPRRHLGPSEKVQVTEAKADGALT


    Database link: O15438

  • Positive control

    • Human colon tissue; A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes.
  • Tissue specificity

    Mainly expressed in the liver. Also expressed in small intestine, colon, prostate, testis, brain and at a lower level in the kidney.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABC 31 antibody
    • ABC31 antibody
    • ABCC 3 antibody
    • ABCC3 antibody
    • ATP binding cassette sub family C (CFTR/MRP) member 3 antibody
    • ATP binding cassette sub family C member 3 antibody
    • ATP-binding cassette sub-family C member 3 antibody
    • Canalicular multispecific organic anion transporter 2 antibody
    • Canicular multispecific organic anion transporter antibody
    • CMOAT 2 antibody
    • CMOAT2 antibody
    • EST90757 antibody
    • MLP 2 antibody
    • MLP2 antibody
    • MOAT D antibody
    • MOAT-D antibody
    • MOATD antibody
    • MRP 3 antibody
    • MRP3_HUMAN antibody
    • Multi specific organic anion transporter D antibody
    • Multi-specific organic anion transporter D antibody
    • Multidrug resistance associated protein 3 antibody
    • Multidrug resistance associated protein antibody
    • Multidrug resistance-associated protein 3 antibody
    • Multispecific organic anion tranporter D antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue, labeling MRP3 with ab204322 at 1/50 dilution.

  • Immunofluorescent analysis of A549 cells (PFA-fixed/Triton X-100 permeabilized) labeling MRP3 with ab204322 at 4 µg/ml.

References

ab204322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up