Overview

  • Product name

  • Description

    Rabbit polyclonal to MRP6/ARA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MRP6/ARA aa 61-99.
    Sequence:

    GYLQMSPLFKAKMVAAIPGSLEPGNGGGRQGTGWNLVKS


    Database link: O95255-2

  • Positive control

    • HepG2 cells.
  • General notes

     This product was previously labelled as MRP6

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May participate directly in the active transport of drugs into subcellular organelles or influence drug distribution indirectly. Transports glutathione conjugates as leukotriene-c4 (LTC4) and N-ethylmaleimide S-glutathione (NEM-GS).
  • Tissue specificity

    Expressed in kidney and liver. Very low expression in other tissues.
  • Involvement in disease

    Defects in ABCC6 are the cause of pseudoxanthoma elasticum (PXE) [MIM:264800]. PXE is a disorder characterized by calcification of elastic fibers in skin, arteries and retina that results in dermal lesions with associated laxity and loss of elasticity, arterial insufficiency and retinal hemorrhages leading to macular degeneration. PXE is caused in the overwhelming majority of cases by homozygous or compound heterozygous mutations in the ABCC6 gene (autosomal recessive PXE). Individuals carrying heterozygous mutations express limited manifestations of the pseudoxanthoma elasticum phenotype (autosomal dominant PXE).
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Membrane. Localized to the basolateral membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABC34 antibody
    • Abcc6 antibody
    • Anthracycline resistance-associated protein antibody
    • ARA antibody
    • ATP binding cassette sub family C (CFTR/MRP) member 6 antibody
    • ATP binding cassette sub family C member 6 antibody
    • ATP-binding cassette sub-family C member 6 antibody
    • EST349056 antibody
    • GACI2 antibody
    • MLP1 antibody
    • MOAT E antibody
    • MOAT-E antibody
    • MOATE antibody
    • MRP 6 antibody
    • MRP6 antibody
    • MRP6_HUMAN antibody
    • Multi-specific organic anion transporter E antibody
    • Multidrug resistance associated protein 6 antibody
    • Multidrug resistance-associated protein 6 antibody
    • Multidrug resistance-associated protein 6; URG7 protein antibody
    • multispecific organic anion transporter E antibody
    • PXE antibody
    • PXE1 antibody
    • URG7 antibody
    • URG7 protein antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HepG2 cells labeling MRP6/ARA with ab220144 at 4 µg/ml (green).  

References

ab220144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up