Anti-MRP8 antibody (ab196680)
Key features and details
- Rabbit polyclonal to MRP8
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-MRP8 antibody
See all MRP8 primary antibodies -
Description
Rabbit polyclonal to MRP8 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant full length protein corresponding to Human MRP8 aa 1-93.
Sequence:MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKG ADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Database link: P05109 -
Positive control
- THP-1 cell extracts; Rat kidney tissue; MCF-7 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine), 0.87% Sodium chloride
PBS without Mg2+ and Ca2+. -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab196680 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/200. | |
IHC-P | 1/50 - 1/100. | |
WB | 1/500 - 1/2000. Predicted molecular weight: 11 kDa. |
Target
-
Function
Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions. -
Tissue specificity
Expressed by macrophages in chronic inflammations. Also expressed in epithelial cells constitutively or induced during dermatoses. -
Sequence similarities
Belongs to the S-100 family.
Contains 2 EF-hand domains. -
Cellular localization
Secreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation. - Information by UniProt
-
Database links
- Entrez Gene: 6279 Human
- Entrez Gene: 116547 Rat
- Omim: 123885 Human
- SwissProt: P05109 Human
- SwissProt: P50115 Rat
- Unigene: 416073 Human
- Unigene: 31839 Rat
-
Alternative names
- 60B8Ag antibody
- AI323541 antibody
- B8Ag antibody
see all
Images
-
Anti-MRP8 antibody (ab196680) at 1/500 dilution + THP-1 cell extract.
Predicted band size: 11 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MRP8 antibody (ab196680)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue labeling MRP8 with ab196680 at 1/100 dilution.
-
Immunofluorescent analysis of MCF-7 cells labeling MRP8 with ab196680 at 1/50 dilution. Blue: DAPI for nuclear staining.
Protocols
Datasheets and documents
References (0)
ab196680 has not yet been referenced specifically in any publications.