For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    mrp8-antibody-ab196680.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Macrophage / Inflamm.
Share by email

Anti-MRP8 antibody (ab196680)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-MRP8 antibody (ab196680)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MRP8 antibody (ab196680)
  • Immunocytochemistry/ Immunofluorescence - Anti-MRP8 antibody (ab196680)

Key features and details

  • Rabbit polyclonal to MRP8
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Rat, Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human MRP8 protein (ab167749)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-MRP8 antibody
    See all MRP8 primary antibodies
  • Description

    Rabbit polyclonal to MRP8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human MRP8 aa 1-93.
    Sequence:

    MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKG ADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE


    Database link: P05109
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • THP-1 cell extracts; Rat kidney tissue; MCF-7 cells.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine), 0.87% Sodium chloride

    PBS without Mg2+ and Ca2+.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Immunology
    • Innate Immunity
    • Macrophage / Inflamm.
    • Signal Transduction
    • Signaling Pathway
    • Calcium Signaling
    • Calcium Binding Proteins
    • Neuroscience
    • Cell Type Marker
    • Glia marker
    • Microglia marker
    • Cancer
    • Drug resistance
    • MRP-related proteins

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • THP1 whole cell lysate (ab7913)
  • Recombinant Protein

    • Recombinant Human MRP8 protein (ab167749)
  • Related Products

    • Recombinant Human MRP8 protein (ab167749)
    • Recombinant Human MRP8 protein (ab95343)

Applications

Our Abpromise guarantee covers the use of ab196680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/50 - 1/100.
WB 1/500 - 1/2000. Predicted molecular weight: 11 kDa.

Target

  • Function

    Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions.
  • Tissue specificity

    Expressed by macrophages in chronic inflammations. Also expressed in epithelial cells constitutively or induced during dermatoses.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Secreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation.
  • Target information above from: UniProt accession P05109 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 6279 Human
    • Entrez Gene: 116547 Rat
    • Omim: 123885 Human
    • SwissProt: P05109 Human
    • SwissProt: P50115 Rat
    • Unigene: 416073 Human
    • Unigene: 31839 Rat
    • Alternative names

      • 60B8Ag antibody
      • AI323541 antibody
      • B8Ag antibody
      • BEE11 antibody
      • CAGA antibody
      • Calgranulin-A antibody
      • Calprotectin L1L subunit antibody
      • Calprotectin, included antibody
      • CFAG antibody
      • CGLA antibody
      • Chemotactic cytokine CP-10 antibody
      • CP-10 antibody
      • Cystic fibrosis antigen antibody
      • L1Ag antibody
      • Leukocyte L1 complex light chain antibody
      • MA387 antibody
      • MIF antibody
      • Migration inhibitory factor-related protein 8 antibody
      • MRP-8 antibody
      • Myeloid-related protein 8 antibody
      • Neutrophil cytosolic 7 kDa protein antibody
      • NIF antibody
      • p8 antibody
      • Pro-inflammatory S100 cytokine antibody
      • Protein S100-A8 antibody
      • S100 calcium binding protein A8 (calgranulin A) antibody
      • S100 calcium binding protein A8 antibody
      • S100 calcium-binding protein A8 antibody
      • S100A8 antibody
      • S100A8/S100A9 complex, included antibody
      • S10A8_HUMAN antibody
      • Urinary stone protein band A antibody
      see all

    Images

    • Western blot - Anti-MRP8 antibody (ab196680)
      Western blot - Anti-MRP8 antibody (ab196680)
      Anti-MRP8 antibody (ab196680) at 1/500 dilution + THP-1 cell extract.

      Predicted band size: 11 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MRP8 antibody (ab196680)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MRP8 antibody (ab196680)

      Immunohistochemical analysis of paraffin-embedded rat kidney tissue labeling MRP8 with ab196680 at 1/100 dilution.

    • Immunocytochemistry/ Immunofluorescence - Anti-MRP8 antibody (ab196680)
      Immunocytochemistry/ Immunofluorescence - Anti-MRP8 antibody (ab196680)

      Immunofluorescent analysis of MCF-7 cells labeling MRP8 with ab196680 at 1/50 dilution. Blue: DAPI for nuclear staining.

    Protocols

    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab196680? Please let us know so that we can cite the reference in this datasheet.

    ab196680 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab196680.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.