Anti-MRP8 antibody (ab196680)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MRP8 antibody
See all MRP8 primary antibodies -
Description
Rabbit polyclonal to MRP8 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant full length protein corresponding to Human MRP8 aa 1-93.
Sequence:MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKG ADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Database link: P05109 -
Positive control
- THP-1 cell extracts; Rat kidney tissue; MCF-7 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride
PBS without Mg2+ and Ca2+. -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab196680 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | 1/50 - 1/200. | |
| IHC-P | 1/50 - 1/100. | |
| WB | 1/500 - 1/2000. Predicted molecular weight: 11 kDa. |
Target
-
Function
Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions. -
Tissue specificity
Expressed by macrophages in chronic inflammations. Also expressed in epithelial cells constitutively or induced during dermatoses. -
Sequence similarities
Belongs to the S-100 family.
Contains 2 EF-hand domains. -
Cellular localization
Secreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation. - Information by UniProt
-
Database links
- Entrez Gene: 6279 Human
- Entrez Gene: 116547 Rat
- Omim: 123885 Human
- SwissProt: P05109 Human
- SwissProt: P50115 Rat
- Unigene: 416073 Human
- Unigene: 31839 Rat
-
Alternative names
- 60B8Ag antibody
- AI323541 antibody
- B8Ag antibody
see all
Images
-
Western blot - Anti-MRP8 antibody (ab196680)Anti-MRP8 antibody (ab196680) at 1/500 dilution + THP-1 cell extract.
Predicted band size: 11 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MRP8 antibody (ab196680)Immunohistochemical analysis of paraffin-embedded rat kidney tissue labeling MRP8 with ab196680 at 1/100 dilution.
-
Immunocytochemistry/ Immunofluorescence - Anti-MRP8 antibody (ab196680)Immunofluorescent analysis of MCF-7 cells labeling MRP8 with ab196680 at 1/50 dilution. Blue: DAPI for nuclear staining.
Protocols
Datasheets and documents
References
ab196680 has not yet been referenced specifically in any publications.
