Overview

  • Product name

  • Description

    Rabbit polyclonal to MRP8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Pig MRP8 aa 1-89. Expressed in E. coli. N-terminal tags.
    Sequence:

    MLTDLESAINSLIEVFHKYSLEKGNYHAIYADDLKRLLETECPKYMKKKD AETWFKELDINKDGAVNFEEFLILVIKVGVEAHEDIHKE


    Database link: C3S7K5

  • Positive control

    • WB: Recombinant pig MRP8 protein; Pig spleen, lung and lymph node lysate; Human leukocyte lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 10 kDa.

Target

  • Function

    Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions.
  • Tissue specificity

    Expressed by macrophages in chronic inflammations. Also expressed in epithelial cells constitutively or induced during dermatoses.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Secreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation.
  • Information by UniProt
  • Database links

  • Alternative names

    • 60B8Ag antibody
    • AI323541 antibody
    • B8Ag antibody
    • BEE11 antibody
    • CAGA antibody
    • Calgranulin-A antibody
    • Calprotectin L1L subunit antibody
    • Calprotectin, included antibody
    • CFAG antibody
    • CGLA antibody
    • Chemotactic cytokine CP-10 antibody
    • CP-10 antibody
    • Cystic fibrosis antigen antibody
    • L1Ag antibody
    • Leukocyte L1 complex light chain antibody
    • MA387 antibody
    • MIF antibody
    • Migration inhibitory factor-related protein 8 antibody
    • MRP-8 antibody
    • Myeloid-related protein 8 antibody
    • Neutrophil cytosolic 7 kDa protein antibody
    • NIF antibody
    • p8 antibody
    • Pro-inflammatory S100 cytokine antibody
    • Protein S100-A8 antibody
    • S100 calcium binding protein A8 (calgranulin A) antibody
    • S100 calcium binding protein A8 antibody
    • S100 calcium-binding protein A8 antibody
    • S100A8 antibody
    • S100A8/S100A9 complex, included antibody
    • S10A8_HUMAN antibody
    • Urinary stone protein band A antibody
    see all

Images

  • Anti-MRP8 antibody (ab231215) at 2 µg/ml + Human leukocyte lysate

    Predicted band size: 10 kDa

  • Anti-MRP8 antibody (ab231215) at 2 µg/ml + Pig lymph node lysate

    Predicted band size: 10 kDa

  • Anti-MRP8 antibody (ab231215) at 2 µg/ml + Pig spleen lysate

    Predicted band size: 10 kDa

  • Anti-MRP8 antibody (ab231215) at 2 µg/ml + Pig lung lysate

    Predicted band size: 10 kDa

  • Anti-MRP8 antibody (ab231215) at 2 µg/ml + Recombinant pig MRP8 protein

    Predicted band size: 10 kDa

References

ab231215 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up