Overview

  • Product name

  • Description

    Rabbit polyclonal to MRP8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to Human MRP8 aa 1295-1344 (internal sequence).
    Sequence:

    NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH


    Database link: NP_149163

  • Positive control

    • NCI-H226 cell lysate
  • General notes

     This product was previously labelled as ABCC11

     

Properties

Applications

Our Abpromise guarantee covers the use of ab98979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 154 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Participates in physiological processes involving bile acids, conjugated steroids and cyclic nucleotides. Enhances the cellular extrusion of cAMP and cGMP. Stimulates the ATP-dependent uptake of a range of physiological and synthetic lipophilic anions, including the glutathione S-conjugates leukotriene C4 and dinitrophenyl S-glutathione, steroid sulfates such as dehydroepiandrosterone 3-sulfate (DHEAS) and estrone 3-sulfate, glucuronides such as estradiol 17-beta-D-glucuronide (E(2)17betaG), the monoanionic bile acids glycocholate and taurocholate, and methotrexate. Probably functions to secrete earwax.
  • Tissue specificity

    Expressed in many tissues. Not expressed in kidney, spleen and colon. Highly expressed in breast cancer. Expressed at moderate levels in normal breast and testis and at very low levels in liver, brain and placenta.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABCC 11 antibody
    • ABCC11 antibody
    • ABCCB_HUMAN antibody
    • ATP binding cassette protein C11 antibody
    • ATP binding cassette sub family C (CFTR/MRP) member 11 antibody
    • ATP binding cassette sub family C member 11 antibody
    • ATP binding cassette transporter MRP8 antibody
    • ATP binding cassette transporter sub family C member 11 antibody
    • ATP-binding cassette sub-family C member 11 antibody
    • EWWD antibody
    • MRP8 antibody
    • Multi resistance protein 8 antibody
    • Multidrug resistance associated protein 8 antibody
    • Multidrug resistance-associated protein 8 antibody
    • OTTHUMP00000164191 antibody
    • WW antibody
    see all

Images

  • Anti-MRP8 antibody (ab98979) at 1 µg/ml + NCI-H226 cell lysate at 10 µg

    Predicted band size: 154 kDa



    Gel concentration: 6-18%

References

ab98979 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98979.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up