Anti-MRPL2 antibody (ab238684)
Key features and details
- Rabbit polyclonal to MRPL2
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MRPL2 antibody -
Description
Rabbit polyclonal to MRPL2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow
-
Immunogen
Recombinant fragment corresponding to Human MRPL2 aa 61-305.
Sequence:ANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFL RFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAG DTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAA GTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKA GRNRWLGKRPNSGRWHRKGGWAGRKIRPLPPMKSYVKLPSASAQS
Database link: Q5T653 -
Positive control
- IHC-P: Human gastric cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab238684 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. |
Target
-
Sequence similarities
Belongs to the ribosomal protein L2P family. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 514403 Cow
- Entrez Gene: 51069 Human
- Entrez Gene: 27398 Mouse
- Entrez Gene: 301240 Rat
- Omim: 611822 Human
- SwissProt: Q2TA12 Cow
- SwissProt: Q5T653 Human
- SwissProt: Q9D773 Mouse
see all -
Alternative names
- 39S ribosomal protein L2 antibody
- 39S ribosomal protein L2, mitochondrial precursor antibody
- CGI22 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MRPL2 antibody (ab238684)
Paraffin-embedded human gastric cancer tissue stained for MRPL2 using ab238684 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab238684 has not yet been referenced specifically in any publications.
