Overview

  • Product name

    Anti-MRPL37 antibody
  • Description

    Rabbit polyclonal to MRPL37
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human MRPL37 aa 123-196.
    Sequence:

    LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPK RETYCPVIVDNLIQLCKSQILKHP


    Database link: Q9BZE1

  • Positive control

    • IHC-P: Human duodenum tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    MRPL37 belongs to the ribosomal protein S30/L37 family. It is a component of the 39S subunit of mitochondrial ribosome.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • 2300004O14Rik antibody
    • 39S ribosomal protein L2, mitochondrial antibody
    • 39S ribosomal protein L37, mitochondrial antibody
    • AI132596 antibody
    • L37mt antibody
    • MGC878 antibody
    • MGC94649, antibody
    • Mitochondrial ribosomal protein L37 antibody
    • MRP L2 antibody
    • MRP L37 antibody
    • MRPL2 antibody
    • OTTMUSP00000008749 antibody
    • Ribosomal protein, mitochondrial, L2 antibody
    • RP23-97J2.3 antibody
    • RPML2 antibody
    see all

Images

  • PFA-fixed/Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for MRPL37 (green) using ab224467 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human duodenum tissue stained for MRPL37 with ab224467 (1/20 dilution) in immunohistochemical analysis.

References

ab224467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up