Anti-MRPL47 antibody (ab220005)
Key features and details
- Rabbit polyclonal to MRPL47
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MRPL47 antibody -
Description
Rabbit polyclonal to MRPL47 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MRPL47 aa 194-250.
Sequence:YNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPHLAE AQKSSLV
Database link: Q9HD33 -
Positive control
- RT-4 and U-251 MG cell lysates; CACO-2 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220005 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. | |
| WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 29 kDa. |
Target
-
Sequence similarities
Belongs to the ribosomal protein L47em family. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 57129 Human
- Omim: 611852 Human
- SwissProt: Q9HD33 Human
- Unigene: 283734 Human
-
Alternative names
- 39S ribosomal protein L47 mitochondrial antibody
- 39S ribosomal protein L47, mitochondrial antibody
- CGI 204 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-MRPL47 antibody (ab220005)
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized CACO-2 cells labeling MRPL47 with ab220005 at 4 µg/mL (green).
-
Western blot - Anti-MRPL47 antibody (ab220005)All lanes : Anti-MRPL47 antibody (ab220005) at 1/250 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Predicted band size: 29 kDa
Protocols
Datasheets and documents
References (0)
ab220005 has not yet been referenced specifically in any publications.
