Overview

  • Product name

  • Description

    Rabbit polyclonal to MRPL48
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human MRPL48 aa 29-212.
    Sequence:

    SGEKPIYSVGGILLSISRPYKTKPTHGIGKYKHLIKAEEPKKKKGKVEVR AINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIKVEESYAMP TKTIEVLQLQDQGSKMLLDSVLTTHERVVQISGLSATFAEIFLEIIQSSL PEGVRLSVKEHTEEDFKGRFKARPELEELLAKLK


    Database link: Q96GC5

  • Positive control

    • WB: Mouse heart lysate. IHC-P: Human cervical cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235519 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 24 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • Anti-MRPL48 antibody (ab235519) at 1/500 dilution + Mouse heart lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 24 kDa

  • Paraffin-embedded human cervical cancer tissue stained for MRPL48 using ab235519 at 1/100 dilution in immunohistochemical analysis.

References

ab235519 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235519.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up