Overview

  • Product name

  • Description

    Rabbit polyclonal to MRPL51
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MRPL51 aa 64-123.
    Sequence:

    GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKR IRYLYKHFNR


    Database link: Q4U2R6

  • Positive control

    • IHC-P: Human duodenum tissue. WB: RT4 and U-251 MG cell lysate. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 39S ribosomal protein L51 antibody
    • 39S ribosomal protein L51 mitochondrial antibody
    • bMRP-64 antibody
    • bMRP64 antibody
    • CDA09 antibody
    • HSPC241 antibody
    • L51mt antibody
    • mitochondrial antibody
    • mitochondrial ribosomal protein 64 antibody
    • mitochondrial ribosomal protein bMRP64 antibody
    • mitochondrial ribosomal protein L51 antibody
    • MRP-L51 antibody
    • MRP64 antibody
    • mrpl51 antibody
    • RM51_HUMAN antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling MRPL51 using ab243821 at 4 µg/ml (green) in ICC/IF.

  • All lanes : Anti-MRPL51 antibody (ab243821) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate

    Predicted band size: 15 kDa

  • Formalin-fixed, paraffin-embedded human duodenum tissue stained for MRPL51 with ab243821 at a 1/50 dilution in immunohistochemical analysis.

References

ab243821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up