Overview

  • Product name

  • Description

    Rabbit polyclonal to MRPP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human MRPP3 aa 314-583.
    Sequence:

    YPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPE EYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNV AKMFPKVRESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEV QKQASCFFADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKT QRLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPYDED LVERCSCEVPTKWLCLHQKT


    Database link: O15091

  • Positive control

    • WB: LO2 and HEK-293T whole cell lysates. IHC-P: Human colon cancer and testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 67 kDa (predicted molecular weight: 67 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

    • Alternative names

      • Kiaa0391 antibody
      • KIAA0391 gene antibody
      • Mitochondrial ribonuclease P protein 3 antibody
      • Mitochondrial RNase P protein 3 antibody
      • Mitochondrial RNase P subunit 3 antibody
      • MRPP3 antibody
      • MRRP3_HUMAN antibody
      • PRORP antibody
      • Proteinaceous RNase P antibody
      see all

    Images

    • All lanes : Anti-MRPP3 antibody (ab230211) at 1/1000 dilution

      Lane 1 : LO2 whole cell lysate
      Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

      Predicted band size: 67 kDa
      Observed band size: 67 kDa

    • Paraffin-embedded human colon cancer tissue stained for MRPP3 using ab230211 at 1/100 dilution in immunohistochemical analysis.

    • Paraffin-embedded human testis tissue stained for MRPP3 using ab230211 at 1/100 dilution in immunohistochemical analysis.

    References

    ab230211 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab230211.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up