Overview

  • Product name

  • Description

    Rabbit polyclonal to MRPP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MRPP3 aa 314-583.
    Sequence:

    PGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEE YECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVA KMFPKVRESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQ KQASCFFADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQ RLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPYDEDL VERCSCEVPTKWLCLHQKT


    Database link: O15091

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • Kiaa0391 antibody
    • KIAA0391 gene antibody
    • Mitochondrial ribonuclease P protein 3 antibody
    • Mitochondrial RNase P protein 3 antibody
    • Mitochondrial RNase P subunit 3 antibody
    • MRPP3 antibody
    • MRRP3_HUMAN antibody
    • PRORP antibody
    • Proteinaceous RNase P antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for MRPP3 with ab230246 at 1/100 dilution in immunohistochemical analysis.

References

ab230246 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up