Overview

  • Product name

  • Description

    Rabbit polyclonal to MRPS16
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human MRPS16 aa 1-137.
    Sequence:

    MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQ LGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLH PMMITNAERLRRKRAREVLLASQKTDAEATDTEATET


    Database link: Q9Y3D3

  • Positive control

    • WB: Mouse liver tissue lysate; HEK-293T, Jurkat, Raji and HepG2 whole cell lysates. IHC-P: Human tonsil and heart tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab235370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 15 kDa.
IHC-P 1/20 - 1/200.

Target

  • Involvement in disease

    Defects in MRPS16 are the cause of combined oxidative phosphorylation deficiency type 2 (COXPD2) [MIM:610498]. Defects in the mitochondrial oxidative phosphorylation system result in devastating, mainly multisystem, diseases. COXPD2 symptoms include fatal neonatal metabolic acidosis with agenesis of the corpus callosum.
  • Sequence similarities

    Belongs to the ribosomal protein S16P family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 28S ribosomal protein S16 antibody
    • 28S ribosomal protein S16 mitochondrial antibody
    • CGI-132 antibody
    • COXPD2 antibody
    • mitochondrial antibody
    • Mitochondrial ribosomal protein S16 antibody
    • MRP-S16 antibody
    • mrps16 antibody
    • RPMS16 antibody
    • RT16_HUMAN antibody
    • S16mt antibody
    see all

Images

  • All lanes : Anti-MRPS16 antibody (ab235370) at 1/1000 dilution

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 4 : Raji (human Burkitt's lymphoma cell line) whole cell lysate
    Lane 5 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 15 kDa

  • Paraffin-embedded human tonsil tissue stained for MRPS16 using ab235370 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human heart tissue stained for MRPS16 using ab235370 at 1/100 dilution in immunohistochemical analysis.

References

ab235370 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up