Overview

  • Product name

    Anti-MRPS22 antibody
  • Description

    Rabbit polyclonal to MRPS22
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human MRPS22 aa 65-184.
    Sequence:

    TKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEA TRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYS IPHRERFIVVREPSGTLRKA


    Database link: P82650

  • Positive control

    • WB: RT4, U-251 MG sp, NIH/3T3 and NBT-II cell lysates. IHC-P: Human lymph node tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 41 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • All lanes : Anti-MRPS22 antibody (ab224341) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Predicted band size: 41 kDa

  • Paraffin-embedded human lymph node tissue stained for MRPS22 using ab224341 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-MRPS22 antibody (ab224341) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 41 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for MRPS22 (green) using ab224341 at 4 µg/ml in ICC/IF.

References

ab224341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up