Overview

  • Product name

    Anti-MRPS28 antibody
  • Description

    Rabbit polyclonal to MRPS28
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MRPS28 aa 72-187. Full-length mature chain without transit peptide.
    Sequence:

    GSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFH CVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLG IQESKDSRSKEEHHEK


    Database link: Q9Y2Q9

  • Positive control

    • IHC-P: Human appendix and adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 28S ribosomal protein S28 antibody
    • 28S ribosomal protein S35 antibody
    • HSPC007 antibody
    • Mitochondrial 28S ribosomal protein S35 antibody
    • mitochondrial antibody
    • Mitochondrial ribosomal protein S28 antibody
    • MRP-S28 antibody
    • MRP-S35 antibody
    • MRPS 28 antibody
    • mrps28 antibody
    • MRPS35 antibody
    • RT28_HUMAN antibody
    • S28mt antibody
    • S35mt antibody
    see all

Images

  • Paraffin-embedded human appendix tissue stained for MRPS28 using ab238861 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for MRPS28 using ab238861 at 1/100 dilution in immunohistochemical analysis.

References

ab238861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up