Anti-MRPS31 antibody (ab235331)
Key features and details
- Rabbit polyclonal to MRPS31
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MRPS31 antibody
See all MRPS31 primary antibodies -
Description
Rabbit polyclonal to MRPS31 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human MRPS31 aa 66-395. Full length mature chain without transit peptide.
Sequence:ICSKKDKQSVRTEETSKETSESQDSEKENTKKDLLGIIKGMKVELSTVNV RTTKPPKRRPLKSLEATLGRLRRATEYAPKKRIEPLSPELVAAASAVADS LPFDKQTTKSELLSQLQQHEEESRAQRDAKRPKISFSNIISDMKVARSAT ARVRSRPELRIQFDEGYDNYPGQEKTDDLKKRKNIFTGKRLNIFDMMAVT KEAPETDTSPSLWDVEFAKQLATVNEQPLQNGFEELIQWTKEGKLWEFPI NNEAGFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSKNPYLS VKQKVEHIEWFRNYFNEKKDILKESNIQFN
Database link: Q92665 -
Positive control
- WB: HeLa, MCF7 and Jurkat whole cell lysate. IHC-P: Human gastric cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab235331 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/1000. Predicted molecular weight: 45 kDa. | |
IHC-P | 1/20 - 1/200. |
Target
-
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 10240 Human
- Omim: 611992 Human
- SwissProt: Q92665 Human
- Unigene: 596607 Human
-
Alternative names
- 28S ribosomal protein S31 antibody
- 28S ribosomal protein S31, mitochondrial antibody
- Imogen 38 antibody
see all
Images
-
All lanes : Anti-MRPS31 antibody (ab235331) at 1/500 dilution
Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 45 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MRPS31 antibody (ab235331)
Paraffin-embedded human gastric cancer tissue stained for MRPS31 with ab235331 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235331 has not yet been referenced specifically in any publications.