Overview

  • Product name

  • Description

    Rabbit polyclonal to MRPS7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human MRPS7 aa 82-161.
    Sequence:

    TSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASA EEQATIERNPYTIFHQALKNCEPMIGLVPI


    Database link: Q9Y2R9

  • Positive control

    • IHC-P: Human liver tissue. WB: NIH/3T3 and NBT-II cell lysates. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 28 kDa.

Target

Images

  • Paraffin-embedded human liver tissue stained for MRPS7 using ab224442 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-MRPS7 antibody (ab224442) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 28 kDa

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for MRPS7 (green) using ab224442 at 4 µg/ml in ICC/IF.

References

ab224442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up