Overview

  • Product name

  • Description

    Rabbit polyclonal to MRPS9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human MRPS9 aa 48-129.
    Sequence:

    RLRHTAFVIPKKNVPTSKRETYTEDFIKKQIEEFNIGKRHLANMMGEDPE TFTQEDIDRAIAYLFPSGLFEKRARPVMKHPE


    Database link: P82933

  • Positive control

    • Human cell lines RT-4 & U-251MG sp, Human colon tissue, A-431 cells

Properties

Applications

Our Abpromise guarantee covers the use of ab187906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
WB 1/100 - 1/250. Predicted molecular weight: 46 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Belongs to the ribosomal protein S9P family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 28S ribosomal protein S9 antibody
    • 28S ribosomal protein S9 mitochondrial antibody
    • 28S ribosomal protein S9 mitochondrial precursor antibody
    • mitochondrial antibody
    • mitochondrial ribosomal protein S9 antibody
    • MRP S9 antibody
    • MRP-S9 antibody
    • MRPS9 antibody
    • RPMS9 antibody
    • RT09_HUMAN antibody
    • S9mt antibody
    see all

Images

  • All lanes : Anti-MRPS9 antibody (ab187906) at 1/100 dilution

    Lane 1 : Human cell line RT-4 lysate
    Lane 2 : Human cell line U-251MG sp lysate

    Secondary
    All lanes : HRP-conjugated swine anti-rabbit immunoglobulin at 1/3000 dilution

    Developed using the ECL technique.

    Predicted band size: 46 kDa


    Exposure time: 1 minute
  • Immunofluorescence analysis of A-431cells labeling MRPS9 with ab187906 at 4µg/ml.

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling MRPS9 with ab187906 at 1/200 dilution.

References

This product has been referenced in:

  • Hartmann H  et al. Proteomics and C9orf72 neuropathology identify ribosomes as poly-GR/PR interactors driving toxicity. Life Sci Alliance 1:e201800070 (2018). Read more (PubMed: 30456350) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up