Overview

  • Product name

  • Description

    Rabbit polyclonal to MRRF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MRRF aa 56-262.
    Sequence:

    ATKKAKAKGKGQSQTRVNINAALVEDIINLEEVNEEMKSVIEALKDNFNK TLNIRTSPGSLDKIAVVTADGKLALNQISQISMKSPQLILVNMASFPECT AAAIKAIRESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQNTNKAK DSLRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDTVAELDRHLAV KTKELLG


    Database link: Q96E11

  • Positive control

    • IHC-P: Human lung cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another.
  • Sequence similarities

    Belongs to the RRF family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2400002D02Rik antibody
    • MGC93722 antibody
    • mitochondrial antibody
    • mitochondrial ribosome recycling factor antibody
    • MRFF antibody
    • Mrrf antibody
    • MTRRF antibody
    • OTTHUMP00000022037 antibody
    • OTTMUSP00000013027 antibody
    • Ribosome recycling factor, mitochondrial antibody
    • Ribosome recycling factor, mitochondrial precursor antibody
    • Ribosome-recycling factor antibody
    • Ribosome-releasing factor antibody
    • Ribosome-releasing factor, mitochondrial antibody
    • RP23-324A16.1 antibody
    • RRF antibody
    • RRFM_HUMAN antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for MRRF using ab238730 at 1/100 dilution in immunohistochemical analysis.

References

ab238730 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up