Overview

  • Product name

  • Description

    Rabbit polyclonal to MRS2/HPT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human MRS2/HPT aa 216-265 (internal sequence).
    Sequence:

    DALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEELL

  • Positive control

    • PANC1 cell lysate
  • General notes

     This product was previously labelled as MRS2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab90295 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    MRS2 is a magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix. There are 3 isoforms produced by alternative splicing.
  • Cellular localization

    Mitochondrion inner membrane; Multi-pass membrane protein (by similarity).
  • Database links

  • Alternative names

    • Gm902 antibody
    • HPT antibody
    • Magnesium transporter MRS2 homolog, mitochondrial antibody
    • MGC78523 antibody
    • MRS2 like protein antibody
    • MRS2 like, magnesium homeostasis factor antibody
    • MRS2 like, magnesium homeostasis factor (S. cerevisiae) antibody
    • MRS2 magnesium homeostasis factor homolog (S. cerevisiae) antibody
    • MRS2L antibody
    • RPT antibody
    see all

Images

  • Anti-MRS2/HPT antibody (ab90295) at 1 µg/ml (in 5% skim milk / PBS buffer) + PANC1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 50 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Hale AT  et al. Endothelial Kruppel-like factor 4 regulates angiogenesis and the Notch signaling pathway. J Biol Chem 289:12016-28 (2014). Read more (PubMed: 24599951) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90295.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up