Overview

  • Product name

  • Description

    Rabbit polyclonal to MS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human MS2 aa 50-100 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQP R


    Database link: P78325

  • Positive control

    • Mouse stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214225 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Possible involvement in extravasation of leukocytes.
  • Tissue specificity

    Expressed on neutrophils and monocytes.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 EGF-like domain.
    Contains 1 peptidase M12B domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • A Disintegrin And Metalloproteinase domain 8 antibody
    • ADAM 8 antibody
    • ADAM 8 precursor antibody
    • ADAM metallopeptidase domain 8 antibody
    • Adam8 antibody
    • ADAM8 protein antibody
    • ADAM8_HUMAN antibody
    • CD 156 antibody
    • CD156 antibody
    • CD156a antibody
    • CD156a antigen antibody
    • Cell surface antigen MS2 antibody
    • Disintegrin and metalloproteinase domain-containing protein 8 antibody
    • Human leukocyte differentiation antigen antibody
    • Macrophage cysteine rich glycoprotein antibody
    • MGC134985 antibody
    • MS 2 antibody
    • MS2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse stomach tissue labeling MS2 with ab214225 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

References

ab214225 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214225.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up