Anti-MS4A10 antibody - N-terminal (ab188257)
Key features and details
- Rabbit polyclonal to MS4A10 - N-terminal
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MS4A10 antibody - N-terminal -
Description
Rabbit polyclonal to MS4A10 - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MS4A10 aa 2-59 (N terminal).
Sequence:KAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQ KKSSLLKE
Database link: Q96PG2 -
Positive control
- Human corpus uterine, liver and liver cancer tissue
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab188257 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May be involved in signal transduction as a component of a multimeric receptor complex. -
Sequence similarities
Belongs to the MS4A family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 341116 Human
- SwissProt: Q96PG2 Human
- Unigene: 591956 Human
-
Alternative names
- CD20 antigen-like 7 antibody
- M4A10_HUMAN antibody
- Membrane-spanning 4-domains subfamily A member 10 antibody
- MS4A10 antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MS4A10 antibody - N-terminal (ab188257)
Immunohistochemical analysis of paraffin embedded Human corpus uterine tissue labeling MS4A10 with ab188257 at 1/200 dilution
Datasheets and documents
References (0)
ab188257 has not yet been referenced specifically in any publications.
