Overview

  • Product name

    Anti-MS4A3/HTM4 antibody
  • Description

    Rabbit polyclonal to MS4A3/HTM4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MS4A3/HTM4 aa 1-45.
    Sequence:

    MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQK


    Database link: Q96HJ5

  • Positive control

    • WB: HEK-293T cells overexpressing MS4A3/HTM4 with C-terminal myc-DDK tag, cell lysate. IHC-P: Human bone marrow tissue.
  • General notes

     This product was previously labelled as MS4A3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 23 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • CD20 antigen homolog antibody
    • CD20 antigen like antibody
    • CD20 antigen like protein antibody
    • CD20 antigen-like protein antibody
    • CD20L antibody
    • hematopoietic cell 4 transmembrane protein antibody
    • Hematopoietic-specific transmembrane protein 4 antibody
    • HTm4 antibody
    • IgE receptor beta subunit antibody
    • Membrane-spanning 4-domains subfamily A member 3 antibody
    • Ms4a3 antibody
    • MS4A3_HUMAN antibody
    • OTTHUMP00000235850 antibody
    • OTTHUMP00000235851 antibody
    • OTTHUMP00000235853 antibody
    see all

Images

  • Paraffin-embedded human bone marrow tissue stained for MS4A3/HTM4 with ab224416 (1/50) in immunohistochemical analysis.

  • All lanes : Anti-MS4A3/HTM4 antibody (ab224416) at 1/100 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with vector only, cell lysate
    Lane 2 : HEK-293T cells transfected with MS4A3/HTM4 with C-terminal myc-DDK tag (~3.1 kDa), cell lysate

    Predicted band size: 23 kDa

References

ab224416 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up