Anti-MSC antibody (ab221097)
Key features and details
- Rabbit polyclonal to MSC
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MSC antibody
See all MSC primary antibodies -
Description
Rabbit polyclonal to MSC -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MSC aa 3-45.
Sequence:TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS
Database link: O60682 -
Positive control
- WB: RT-4 cell lysate. ICC/IF: SK-MEL-30 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab221097 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 22 kDa. |
Target
-
Function
Transcription repressor capable of inhibiting the transactivation capability of TCF3/E47. May play a role in regulating antigen-dependent B-cell differentiation. -
Tissue specificity
Expressed in lymphoid tissues, B-cell lines and activated B-cells. -
Sequence similarities
Contains 1 basic helix-loop-helix (bHLH) domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 9242 Human
- Omim: 603628 Human
- SwissProt: O60682 Human
- Unigene: 442619 Human
-
Alternative names
- ABF-1 antibody
- ABF1 antibody
- Activated B cell factor 1 antibody
see all
Images
-
Anti-MSC antibody (ab221097) at 1/100 dilution + RT-4 cell lysate
Predicted band size: 22 kDa -
Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized SK-MEL-30 cells labeling MSC with ab221097 at 4 μg/mL dilution (green).
Protocols
Datasheets and documents
References (0)
ab221097 has not yet been referenced specifically in any publications.