Anti-MSL2L1 antibody (ab220610)
Key features and details
- Rabbit polyclonal to MSL2L1
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MSL2L1 antibody -
Description
Rabbit polyclonal to MSL2L1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human MSL2L1 aa 431-571.
Sequence:DKAVKEKIPSHHFMPGSPTKTVYKKPQEKKGCKCGRATQNPSVLTCRGQR CPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGIN VTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAI
Database link: Q9HCI7 -
Positive control
- RT4 and U-251 MG cell lysates; U251 MG cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220610 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 63 kDa. |
Target
-
Function
Component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure. -
Sequence similarities
Belongs to the MSL2 family.
Contains 1 RING-type zinc finger. - Information by UniProt
-
Database links
- Entrez Gene: 55167 Human
- Entrez Gene: 77853 Mouse
- SwissProt: Q9HCI7 Human
- SwissProt: Q69ZF8 Mouse
- Unigene: 18631 Human
- Unigene: 326206 Mouse
- Unigene: 436586 Mouse
- Unigene: 485147 Mouse
-
Alternative names
- Male specific lethal 2 homolog (Drosophila) antibody
- Male specific lethal 2 homolog 1 antibody
- Male specific lethal 2 homolog antibody
see all
Images
-
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U251 MG cells labeling MSL2L1 with ab220610 at 4 μg/ml (green).
-
All lanes : Anti-MSL2L1 antibody (ab220610) at 1/100 dilution
Lane 1 : RT4 cell lysate
Lane 2 : U251 MG cell lysate
Predicted band size: 63 kDa
Protocols
Datasheets and documents
References (0)
ab220610 has not yet been referenced specifically in any publications.