Overview

  • Product name

  • Description

    Rabbit polyclonal to MSRA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MSRA aa 166-234.
    Sequence:

    AKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKN PNGYCGLGGTGVSCPVGIK


    Database link: Q9UJ68

  • Positive control

    • MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
  • Tissue specificity

    Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.
  • Sequence similarities

    Belongs to the MsrA Met sulfoxide reductase family.
  • Cellular localization

    Cytoplasm; Cytoplasm. Nucleus and Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytosolic methionine S sulfoxide reductase antibody
    • Methionine sulphoxide reductase A antibody
    • Mitochondrial peptide methionine sulfoxide reductase antibody
    • MSR A antibody
    • msrA antibody
    • MSRA_HUMAN antibody
    • peptide met (O) reductase antibody
    • Peptide Met(O) reductase antibody
    • Peptide methionine (S) S oxide reductase antibody
    • Peptide-methionine (S)-S-oxide reductase antibody
    • PMSR antibody
    • Protein methionine S oxide reductase antibody
    • Protein-methionine-S-oxide reductase antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling MSRA with ab220630 at 4 µg/ml (green).

References

ab220630 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up