Anti-MSRA antibody (ab232901)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MSRA antibody
See all MSRA primary antibodies -
Description
Rabbit polyclonal to MSRA -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human, Pig
Predicted to work with: Cow
-
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human MSRA aa 27-235. (Expressed in E.coli).
Sequence:ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFW GAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPE HMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSK ENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTG VSCPVGIKK
Database link: Q9UJ68 -
Positive control
- WB: Recombinant human MSRA protein; HT1080 and HepG2 cell lysates; Pig and rat kidney lysates. IHC-P: Human brain tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab232901 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab232901 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 26 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. -
Tissue specificity
Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus. -
Sequence similarities
Belongs to the MsrA Met sulfoxide reductase family. -
Cellular localization
Cytoplasm; Cytoplasm. Nucleus and Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 281312 Cow
- Entrez Gene: 4482 Human
- Entrez Gene: 100152960 Pig
- Entrez Gene: 29447 Rat
- Omim: 601250 Human
- SwissProt: P54149 Cow
- SwissProt: Q9UJ68 Human
- SwissProt: Q923M1 Rat
see all -
Alternative names
- Cytosolic methionine S sulfoxide reductase antibody
- Methionine sulphoxide reductase A antibody
- Mitochondrial peptide methionine sulfoxide reductase antibody
see all
Images
-
Western blot - Anti-MSRA antibody (ab232901)Anti-MSRA antibody (ab232901) at 2 µg/ml + Recombinant human MSRA protein
Predicted band size: 26 kDa -
Western blot - Anti-MSRA antibody (ab232901)Anti-MSRA antibody (ab232901) at 2 µg/ml + HT1080 (human fibrosarcoma cell line) cell lysate
Predicted band size: 26 kDa -
Western blot - Anti-MSRA antibody (ab232901)Anti-MSRA antibody (ab232901) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
Predicted band size: 26 kDa -
Western blot - Anti-MSRA antibody (ab232901)Anti-MSRA antibody (ab232901) at 2 µg/ml + Pig kidney lysate
Predicted band size: 26 kDa -
Western blot - Anti-MSRA antibody (ab232901)Anti-MSRA antibody (ab232901) at 3 µg/ml + Rat kidney lysate
Predicted band size: 26 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MSRA antibody (ab232901)Formalin-fixed, paraffin-embedded human brain tissue stained for MSRA using ab232901 at 20 μg/ml in immunohistochemical analysis. DAB staining.
Datasheets and documents
References
ab232901 has not yet been referenced specifically in any publications.
