Anti-MSRA antibody (ab232901)
Key features and details
- Rabbit polyclonal to MSRA
- Suitable for: WB, IHC-P
- Reacts with: Rat, Human, Pig
- Isotype: IgG
Overview
-
Product name
Anti-MSRA antibody
See all MSRA primary antibodies -
Description
Rabbit polyclonal to MSRA -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human, Pig
Predicted to work with: Cow -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human MSRA aa 27-235. (Expressed in E.coli).
Sequence:ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFW GAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPE HMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSK ENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTG VSCPVGIKK
Database link: Q9UJ68 -
Positive control
- WB: Recombinant human MSRA protein; HT1080 and HepG2 cell lysates; Pig and rat kidney lysates. IHC-P: Human brain tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab232901 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab232901 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 26 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. -
Tissue specificity
Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus. -
Sequence similarities
Belongs to the MsrA Met sulfoxide reductase family. -
Cellular localization
Cytoplasm; Cytoplasm. Nucleus and Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 281312 Cow
- Entrez Gene: 4482 Human
- Entrez Gene: 100152960 Pig
- Entrez Gene: 29447 Rat
- Omim: 601250 Human
- SwissProt: P54149 Cow
- SwissProt: Q9UJ68 Human
- SwissProt: Q923M1 Rat
see all -
Alternative names
- Cytosolic methionine S sulfoxide reductase antibody
- Methionine sulphoxide reductase A antibody
- Mitochondrial peptide methionine sulfoxide reductase antibody
see all
Images
-
Anti-MSRA antibody (ab232901) at 2 µg/ml + Recombinant human MSRA protein
Predicted band size: 26 kDa -
Anti-MSRA antibody (ab232901) at 2 µg/ml + HT1080 (human fibrosarcoma cell line) cell lysate
Predicted band size: 26 kDa -
Anti-MSRA antibody (ab232901) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
Predicted band size: 26 kDa -
Anti-MSRA antibody (ab232901) at 2 µg/ml + Pig kidney lysate
Predicted band size: 26 kDa -
Anti-MSRA antibody (ab232901) at 3 µg/ml + Rat kidney lysate
Predicted band size: 26 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MSRA antibody (ab232901)
Formalin-fixed, paraffin-embedded human brain tissue stained for MSRA using ab232901 at 20 μg/ml in immunohistochemical analysis. DAB staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab232901 has not yet been referenced specifically in any publications.