Overview

  • Product name

  • Description

    Rabbit polyclonal to MSRB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human MSRB2 aa 10-182.
    Sequence:

    GLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLT PEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTG WPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPD GPGPNGQRFCINSVALKFKPRKH


    Database link: Q9Y3D2

  • Positive control

    • WB: Mouse heart and brain tissue lysates. IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab229940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 20 kDa.

Target

Images

  • All lanes : Anti-MSRB2 antibody (ab229940) at 1/1000 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 20 kDa
    Observed band size: 20 kDa

  • Paraffin-embedded human colon cancer tissue stained for MSRB2 using ab229940 at 1/100 dilution in immunohistochemical analysis.

References

ab229940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up