Overview

  • Product name

  • Description

    Rabbit polyclonal to MSRB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human MSRB2 aa 10-182.
    Sequence:

    GLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLT PEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTG WPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPD GPGPNGQRFCINSVALKFKPRKH


    Database link: Q9Y3D2

  • Positive control

    • WB: Mouse heart lysate. IHC-P: Human lung cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab229988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 20 kDa (predicted molecular weight: 20 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • Anti-MSRB2 antibody (ab229988) at 1/1000 dilution + Mouse heart lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 20 kDa

  • Paraffin-embedded human lung cancer tissue stained for MSRB2 using ab229988 at 1/100 dilution in immunohistochemical analysis.

References

ab229988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up