Overview

  • Product name

  • Description

    Rabbit polyclonal to MST
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MST aa 124-268.
    Sequence:

    AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENL ESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLE KSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD


    Database link: P25325

  • Positive control

    • IHC: Human duodenum, liver, kidney and prostate tissue. WB: HepG2 whole cell lysate (ab7900). ICC: A431 cells.
  • General notes

    Protein previously labeled as MPST.

Properties

Applications

Our Abpromise guarantee covers the use of ab224043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 33 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. May have a role in cyanide degradation or in thiosulfate biosynthesis.
  • Sequence similarities

    Contains 2 rhodanese domains.
  • Domain

    The structure consists of 2 domains of very similar conformation, suggesting a common evolutionary origin. However, the sequences of the 2 domains are very different.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3 mercaptopyruvate sulfurtransferase antibody
    • 3-mercaptopyruvate sulfurtransferase antibody
    • Human liver rhodanese antibody
    • Mercaptopyruvate sulfurtransferase antibody
    • MGC24539 antibody
    • MPST antibody
    • MST antibody
    • THTM_HUMAN antibody
    • TST2 antibody
    see all

Images

  • Anti-MST antibody (ab224043) at 1/100 dilution + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 33 kDa

  • Paraffin-embedded human duodenum tissue stained for MST using ab224043 at 1/1000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for MST using ab224043 at 1/1000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for MST using ab224043 at 1/1000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for MST using ab224043 at 1/1000 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for MST (green) using ab224043 at 4 µg/ml in ICC/IF.

References

ab224043 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up