Anti-MST3 antibody (ab236589)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MST3 antibody
See all MST3 primary antibodies -
Description
Rabbit polyclonal to MST3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MST3 aa 1-431. Full length isoform A.
Sequence:MAHSPVQSGLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVV AIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIME YLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANV LLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKA DIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEF VEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSH DDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRN KMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAE EACPGISDTMVAQLVQRLQRYSLSGGGTSSH
Database link: Q9Y6E0 -
Positive control
- WB: HeLa, A-375 and HepG2 cell lysate. IHC-P: Human colon cancer tissue. ICC/IF: HeLa cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.03% Proclin
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab236589 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/500. | |
IHC-P | 1/100 - 1/500. | |
WB | 1/500 - 1/5000. |
Target
-
Function
Serine/threonine-protein kinase that acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation. Mediates oxidative-stress-induced cell death by modulating phosphorylation of JNK1-JNK2 (MAPK8 and MAPK9), p38 (MAPK11, MAPK12, MAPK13 and MAPK14) during oxidative stress. Plays a role in a staurosporine-induced caspase-independent apoptotic pathway by regulating the nuclear translocation of AIFM1 and ENDOG and the DNase activity associated with ENDOG. Phosphorylates STK38L on 'Thr-442' and stimulates its kinase activity. Regulates cellular migration with alteration of PTPN12 activity and PXN phosphorylation: phosphorylates PTPN12 and inhibits its activity and may regulate PXN phosphorylation through PTPN12. May act as a key regulator of axon regeneration in the optic nerve and radial nerve. -
Tissue specificity
Isoform A is ubiquitous. Isoform B is expressed in brain with high expression in hippocampus and cerebral cortex. -
Sequence similarities
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Contains 1 protein kinase domain. -
Post-translational
modificationsProteolytically processed by caspases during apoptosis. Proteolytic cleavage results in kinase activation, nuclear translocation of the truncated form (MST3/N) and the induction of apoptosis.
Isoform B is activated by phosphorylation by PKA. Oxidative stress induces phosphorylation. Activated by autophosphorylation at Thr-190 and phosphorylation at this site is essential for its function. Manganese, magnesium and cobalt-dependent autophosphorylation is mainly on threonine residues while zinc-dependent autophosphorylation is on both serine and threonine residues. -
Cellular localization
Cytoplasm. Nucleus. Membrane. The truncated form (MST3/N) translocates to the nucleus. Co-localizes with STK38L in the membrane. - Information by UniProt
-
Database links
- Entrez Gene: 8428 Human
- Omim: 604984 Human
- SwissProt: Q9Y6E0 Human
- Unigene: 508514 Human
-
Alternative names
- epididymis secretory protein Li 95 antibody
- HEL-S-95 antibody
- Mammalian STE20 like protein kinase 3 antibody
see all
Images
-
All lanes : Anti-MST3 antibody (ab236589) at 1/500 dilution
Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Lane 2 : A-375 (human malignant melanoma cell line) cell lysate
Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MST3 antibody (ab236589)
Paraffin-embedded human colon cancer tissue stained for MST3 using ab236589 at 1/100 dilution in immunohistochemical analysis.
-
4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for MST3 using ab236579 at 1/100 dilution in ICC/IF.
Cells were blocked in 10% normal goat serum and incubated with primary antibody overnight at 4°C. Secondary antibody was Alexa Fluor®488-conjugated goat anti-rabbit IgG (H+L).
References
ab236589 has not yet been referenced specifically in any publications.