Overview

  • Product name

  • Description

    Rabbit polyclonal to MST3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MST3 aa 1-431. Full length isoform A.
    Sequence:

    MAHSPVQSGLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVV AIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIME YLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANV LLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKA DIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEF VEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSH DDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRN KMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAE EACPGISDTMVAQLVQRLQRYSLSGGGTSSH


    Database link: Q9Y6E0

  • Positive control

    • WB: HeLa, A-375 and HepG2 cell lysate. IHC-P: Human colon cancer tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/500.
IHC-P 1/100 - 1/500.
WB 1/500 - 1/5000.

Target

  • Function

    Serine/threonine-protein kinase that acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation. Mediates oxidative-stress-induced cell death by modulating phosphorylation of JNK1-JNK2 (MAPK8 and MAPK9), p38 (MAPK11, MAPK12, MAPK13 and MAPK14) during oxidative stress. Plays a role in a staurosporine-induced caspase-independent apoptotic pathway by regulating the nuclear translocation of AIFM1 and ENDOG and the DNase activity associated with ENDOG. Phosphorylates STK38L on 'Thr-442' and stimulates its kinase activity. Regulates cellular migration with alteration of PTPN12 activity and PXN phosphorylation: phosphorylates PTPN12 and inhibits its activity and may regulate PXN phosphorylation through PTPN12. May act as a key regulator of axon regeneration in the optic nerve and radial nerve.
  • Tissue specificity

    Isoform A is ubiquitous. Isoform B is expressed in brain with high expression in hippocampus and cerebral cortex.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Proteolytically processed by caspases during apoptosis. Proteolytic cleavage results in kinase activation, nuclear translocation of the truncated form (MST3/N) and the induction of apoptosis.
    Isoform B is activated by phosphorylation by PKA. Oxidative stress induces phosphorylation. Activated by autophosphorylation at Thr-190 and phosphorylation at this site is essential for its function. Manganese, magnesium and cobalt-dependent autophosphorylation is mainly on threonine residues while zinc-dependent autophosphorylation is on both serine and threonine residues.
  • Cellular localization

    Cytoplasm. Nucleus. Membrane. The truncated form (MST3/N) translocates to the nucleus. Co-localizes with STK38L in the membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • epididymis secretory protein Li 95 antibody
    • HEL-S-95 antibody
    • Mammalian STE20 like protein kinase 3 antibody
    • Mammalian STE20-like protein kinase 3 antibody
    • Mammalian STE20-like protein kinase 3 C-terminal antibody
    • Mammalian STE20-like protein kinase 3 N-terminal antibody
    • Mammalian sterile 20-like 3 antibody
    • MST-3 antibody
    • MST3/C antibody
    • MST3/N antibody
    • MST3B antibody
    • serine threonine kinase 24 antibody
    • Serine/threonine kinase 24 (Ste20, yeast homolog) antibody
    • Serine/threonine-protein kinase 24 12 kDa subunit antibody
    • Serine/threonine-protein kinase 24 antibody
    • STE20 homolog yeast antibody
    • STE20 like kinase MST3 antibody
    • STE20-like kinase MST3 antibody
    • Stk24 antibody
    • STK24_HUMAN antibody
    • STK3 antibody
    see all

Images

  • All lanes : Anti-MST3 antibody (ab236589) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : A-375 (human malignant melanoma cell line) cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human colon cancer tissue stained for MST3 using ab236589 at 1/100 dilution in immunohistochemical analysis.

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for MST3 using ab236579 at 1/100 dilution in ICC/IF.

    Cells were blocked in 10% normal goat serum and incubated with primary antibody overnight at 4°C. Secondary antibody was Alexa Fluor®488-conjugated goat anti-rabbit IgG (H+L).

References

ab236589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up