Overview

  • Product name

  • Description

    Rabbit polyclonal to MST4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MST4 aa 298-372.
    Sequence:

    GHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLV QTLSCLSMIITPAFAELKQQDENNA


    Database link: Q9P289

  • Positive control

    • Human colon tissue; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Mediator of cell growth. Modulates apoptosis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cytoplasm. Golgi apparatus membrane. Localizes to the Golgi apparatus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2610018G03Rik antibody
    • EC 2.7.11.1 antibody
    • Mammalian Ste20 like protein kinase 4 antibody
    • Mammalian STE20-like protein kinase 4 antibody
    • Mammalian sterile 20 like 4 antibody
    • MASK antibody
    • MST 4 antibody
    • MST-4 antibody
    • MST3 and SOK1 related kinase antibody
    • Mst3 and SOK1-related kinase antibody
    • Mst4 antibody
    • MST4_HUMAN antibody
    • RGD1563568 antibody
    • RP23-245F8.1 antibody
    • RP6 213H19.1 antibody
    • Serine/threonine protein kinase 26 antibody
    • Serine/threonine protein kinase MASK antibody
    • Serine/threonine protein kinase MST 4 antibody
    • Serine/threonine protein kinase MST4 antibody
    • Serine/threonine-protein kinase MASK antibody
    • Serine/threonine-protein kinase MST4 antibody
    • STE20 like kinase MST 4 antibody
    • STE20 like kinase MST4 antibody
    • STE20-like kinase MST4 antibody
    • STK26 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling MST4 with ab204794 at 1/500 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling MST4 with ab204794 at 4ug/ml (green).

References

ab204794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up