Overview

  • Product name

  • Description

    Rabbit polyclonal to MSTO1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse MSTO1 aa 13-363. Expressed in E.coli.
    Sequence:

    LGHFAGFVGAHWWNQQDAALGRMAEDEESPGELCPDVLYRTGRTLHGQET YTPRLILMDLKGSLNTLKEEGNLYRDRQLEAAVAWQGKLSTHREDAHPKN PNLQGLLSAEGVRSSDGAWRAKLIQNIQNGKENSIKVWSDFLRVHLHPRS ICVIHKYHHDGETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQ GFQLLCDLHDGFSGVGAKTAELLQDEYAGRGVLTWGLLPGPYSLGEPQKN IYRLLNTAFGLVHLTGYSSFVCPLSLGGNLGLRPKPPVNFPSLHYDATLP FHCSAILATALDTVTVPYRLRSSMVTMAHLADVLSFSGKKVVTAEAIIPF P


    Database link: Q2YDW2

  • Positive control

    • WB: Recombinant mouse MSTO1 protein; Mouse testis lysate. IHC-P: Mouse brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 61 kDa.

Target

  • Relevance

    MSTO1, or misato homolog 1 (Drosophila), is involved in the regulation of mitochondrial distribution and morphology.
  • Cellular localization

    Mitochondrion outer membrane.
  • Database links

  • Alternative names

    • DKFZp686B1757 antibody
    • DKFZp686I01261 antibody
    • FLJ10504 antibody
    • LST005 antibody
    • misato homolog 1 (Drosophila) antibody
    • MST antibody
    • Protein misato homolog 1 antibody
    • RP11 29H23.3 antibody
    see all

Images

  • Anti-MSTO1 antibody (ab233098) at 2 µg/ml + Recombinant mouse MTSO1 protein

    Predicted band size: 61 kDa

  • Anti-MSTO1 antibody (ab233098) at 2 µg/ml + Mouse testis lysate

    Predicted band size: 61 kDa

  • Formalin-fixed, paraffin-embedded mouse brain tissue stained for MTSO1 using ab233098 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up