For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    msx1-antibody-ab168745.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Cell Type Marker Neural Stem Cell marker
Share by email

Anti-MSX1 antibody (ab168745)

  • Datasheet
Reviews (1) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-MSX1 antibody (ab168745)
  • Immunocytochemistry/ Immunofluorescence - Anti-MSX1 antibody (ab168745)

Key features and details

  • Mouse polyclonal to MSX1
  • Suitable for: ICC/IF, WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-MSX1 antibody
    See all MSX1 primary antibodies
  • Description

    Mouse polyclonal to MSX1
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Chimpanzee, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human MSX1 aa 7-303.
    Sequence:

    MTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSP SLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAP DAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPA RRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFS SSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFP LGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT


    Database link: P28360
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Purchase matching WB positive control:Recombinant Human MSX1 protein
    • MSX1 transfected 293T cell lysate. HeLa cells.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.4
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Cell Type Marker
    • Neural Stem Cell marker
    • Neuroscience
    • Neurology process
    • Neurogenesis
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Developmental Families
    • HOX
    • Stem Cells
    • Neural Stem Cells
    • Intracellular
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Transcription Factors
    • Developmental Biology
    • Organogenesis
    • Skeletal development
    • Bone
    • Developmental Biology
    • Organogenesis
    • Nervous system development

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG - Isotype Control (ab37355)

Applications

Our Abpromise guarantee covers the use of ab168745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 10 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa.

Target

  • Function

    Acts as a transcriptional repressor. May play a role in limb-pattern formation. Acts in cranofacial development and specifically in odontogenesis. Expression in the developing nail bed mesenchyme is important for nail plate thickness and integrity.
  • Tissue specificity

    Expressed in the developing nail bed mesenchyme.
  • Involvement in disease

    Defects in MSX1 are the cause of tooth agenesis selective type 1 (STHAG1) [MIM:106600]. A form of selective tooth agenesis, a common anomaly characterized by the congenital absence of one or more teeth. Selective tooth agenesis without associated systemic disorders has sometimes been divided into 2 types: oligodontia, defined as agenesis of 6 or more permanent teeth, and hypodontia, defined as agenesis of less than 6 teeth. The number in both cases does not include absence of third molars (wisdom teeth). Tooth agenesis selective type 1 can be associated with orofacial cleft in some patients.
    Note=MSX1 is deleted in some patients with Wolf-Hirschhorn syndrome (WHS). WHS results from sub-telomeric deletions in the short arm of chromosome 4.
    Defects in MSX1 are the cause of Witkop syndrome (WITS) [MIM:189500]. WITS is a form of ectodermal dyslasia also called tooth-and-nail syndrome or dysplasia of nails with hypodontia. Ectodermal dysplasias (EDs) constitute a heterogeneous group of developmental disorders affecting tissues of ectodermal origin. EDs are characterized by abnormal development of two or more ectodermal structures such as hair, teeth, nails and sweat glands, with or without any additional clinical sign. Each combination of clinical features represents a different type of ectodermal dysplasia. Witkop syndrome is characterized by abnormalities largely limited largely to teeth (some of which are missing) and nails (which are poorly formed early in life, especially toenails). This condition is distinguished from anhidrotic ectodermal dysplasia by autosomal dominant inheritance and little involvement of hair and sweat glands. The teeth are not as severely affected.
    Defects in MSX1 are the cause of non-syndromic orofacial cleft type 5 (OFC5) [MIM:608874]; also called non-syndromic cleft lip with or without cleft palate 5. Non-syndromic orofacial cleft is a common birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum.
  • Sequence similarities

    Belongs to the Msh homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications

    Sumoylated by PIAS1, desumoylated by SENP1.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession P28360 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 461092 Chimpanzee
    • Entrez Gene: 286872 Cow
    • Entrez Gene: 4487 Human
    • Entrez Gene: 17701 Mouse
    • Entrez Gene: 692067 Rhesus monkey
    • Omim: 142983 Human
    • SwissProt: Q2VL88 Chimpanzee
    • SwissProt: O02786 Cow
    • SwissProt: P28360 Human
    • SwissProt: P13297 Mouse
    • SwissProt: Q2VL87 Rhesus monkey
    • Unigene: 424414 Human
    • Unigene: 256509 Mouse
    see all
  • Alternative names

    • AA675338 antibody
    • AI324650 antibody
    • Homeobox 7 antibody
    • Homeobox protein Hox-7 antibody
    • Homeobox protein MSX 1 antibody
    • Homeobox protein MSX-1 antibody
    • Homeobox protein MSX1 antibody
    • Homeobox, msh like 1 antibody
    • Homeobox, msh-like 1 antibody
    • HOX 7 antibody
    • Hox 7.1 antibody
    • Hox-7 antibody
    • HOX7 antibody
    • Hox7.1 antibody
    • HYD 1 antibody
    • HYD1 antibody
    • msh (Drosophila) homeo box homolog 1 (formerly homeo box 7) antibody
    • Msh antibody
    • msh homeo box 1 antibody
    • msh homeo box homolog 1 antibody
    • Msh homeobox 1 antibody
    • Msh homeobox 1 like protein antibody
    • Msh homeobox 1-like protein antibody
    • msh homeobox homolog 1 (Drosophila) antibody
    • msh homeobox homolog 1 antibody
    • MSH, Drosophila, Homolog of, 1 antibody
    • MSX 1 antibody
    • MSX1 antibody
    • MSX1_HUMAN antibody
    • Muscle segment homeobox antibody
    • Muscle segment homeobox, Drosophila, Homolog of, 1 antibody
    • OFC5 antibody
    • OTTHUMP00000115387 antibody
    • STHAG1 antibody
    see all

Images

  • Western blot - Anti-MSX1 antibody (ab168745)
    Western blot - Anti-MSX1 antibody (ab168745)
    All lanes : Anti-MSX1 antibody (ab168745) at 1 µg/ml

    Lane 1 : MSX1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugated secondary antibody at 1/2500 dilution

    Predicted band size: 31 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-MSX1 antibody (ab168745)
    Immunocytochemistry/ Immunofluorescence - Anti-MSX1 antibody (ab168745)
    Immunofluorescence analysis of HeLa cells labelling MSX1 with ab168745 at 10 ug/ml.

Protocols

  • Western blot protocols
  • Immunocytochemistry & immunofluorescence protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab168745? Please let us know so that we can cite the reference in this datasheet.

    ab168745 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Immunocytochemistry/ Immunofluorescence abreview for Anti-MSX1 antibody

    Poor
    Abreviews
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Human Cell (Differentiated human embryonic stem cells)
    Permeabilization
    Yes - PBS/Triton X-100
    Specification
    Differentiated human embryonic stem cells
    Blocking step
    Serum as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 20°C
    Fixative
    Paraformaldehyde
    Read More

    Abcam user community

    Verified customer

    Submitted Dec 23 2016

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.