Anti-MSX1 antibody (ab168745)
Key features and details
- Mouse polyclonal to MSX1
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MSX1 antibody
See all MSX1 primary antibodies -
Description
Mouse polyclonal to MSX1 -
Host species
Mouse -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Chimpanzee, Rhesus monkey -
Immunogen
Recombinant fragment corresponding to Human MSX1 aa 7-303.
Sequence:MTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSP SLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAP DAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPA RRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFS SSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFP LGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Database link: P28360 -
Positive control
- Purchase matching WB positive control:Recombinant Human MSX1 protein
- MSX1 transfected 293T cell lysate. HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab168745 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 10 µg/ml. | |
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa. |
Target
-
Function
Acts as a transcriptional repressor. May play a role in limb-pattern formation. Acts in cranofacial development and specifically in odontogenesis. Expression in the developing nail bed mesenchyme is important for nail plate thickness and integrity. -
Tissue specificity
Expressed in the developing nail bed mesenchyme. -
Involvement in disease
Defects in MSX1 are the cause of tooth agenesis selective type 1 (STHAG1) [MIM:106600]. A form of selective tooth agenesis, a common anomaly characterized by the congenital absence of one or more teeth. Selective tooth agenesis without associated systemic disorders has sometimes been divided into 2 types: oligodontia, defined as agenesis of 6 or more permanent teeth, and hypodontia, defined as agenesis of less than 6 teeth. The number in both cases does not include absence of third molars (wisdom teeth). Tooth agenesis selective type 1 can be associated with orofacial cleft in some patients.
Note=MSX1 is deleted in some patients with Wolf-Hirschhorn syndrome (WHS). WHS results from sub-telomeric deletions in the short arm of chromosome 4.
Defects in MSX1 are the cause of Witkop syndrome (WITS) [MIM:189500]. WITS is a form of ectodermal dyslasia also called tooth-and-nail syndrome or dysplasia of nails with hypodontia. Ectodermal dysplasias (EDs) constitute a heterogeneous group of developmental disorders affecting tissues of ectodermal origin. EDs are characterized by abnormal development of two or more ectodermal structures such as hair, teeth, nails and sweat glands, with or without any additional clinical sign. Each combination of clinical features represents a different type of ectodermal dysplasia. Witkop syndrome is characterized by abnormalities largely limited largely to teeth (some of which are missing) and nails (which are poorly formed early in life, especially toenails). This condition is distinguished from anhidrotic ectodermal dysplasia by autosomal dominant inheritance and little involvement of hair and sweat glands. The teeth are not as severely affected.
Defects in MSX1 are the cause of non-syndromic orofacial cleft type 5 (OFC5) [MIM:608874]; also called non-syndromic cleft lip with or without cleft palate 5. Non-syndromic orofacial cleft is a common birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum. -
Sequence similarities
Belongs to the Msh homeobox family.
Contains 1 homeobox DNA-binding domain. -
Post-translational
modificationsSumoylated by PIAS1, desumoylated by SENP1. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 461092 Chimpanzee
- Entrez Gene: 286872 Cow
- Entrez Gene: 4487 Human
- Entrez Gene: 17701 Mouse
- Entrez Gene: 692067 Rhesus monkey
- Omim: 142983 Human
- SwissProt: Q2VL88 Chimpanzee
- SwissProt: O02786 Cow
see all -
Alternative names
- AA675338 antibody
- AI324650 antibody
- Homeobox 7 antibody
see all
Images
-
All lanes : Anti-MSX1 antibody (ab168745) at 1 µg/ml
Lane 1 : MSX1 transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugated secondary antibody at 1/2500 dilution
Predicted band size: 31 kDa -
Immunofluorescence analysis of HeLa cells labelling MSX1 with ab168745 at 10 ug/ml.
Protocols
Datasheets and documents
References (0)
ab168745 has not yet been referenced specifically in any publications.