Overview

  • Product name

  • Description

    Rabbit polyclonal to Msx2/Hox8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human Msx2/Hox8 aa 43-145.
    Sequence:

    SSLPFSVEALMSDKKPPKEASPLPAESASAGATLRPLLLSGHGAREAHSP GPLVKPFETASVKSENSEDGAAWMQEPGRYSPPPRHTSPTTCTLRKHKTN RKP


    Database link: P35548

  • Positive control

    • IHC-P: Human endometrium, placenta and urinary bladder tissue. WB: Caco-2, BEWO, NIH/3T3 and NBT-II cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab223692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 29 kDa.

Target

  • Function

    Acts as a transcriptional regulator in bone development. Represses the ALPL promoter activity and antogonizes the stimulatory effect of DLX5 on ALPL expression during osteoblast differentiation. Probable morphogenetic role. May play a role in limb-pattern formation. In osteoblasts, suppresses transcription driven by the osteocalcin FGF response element (OCFRE). Binds to the homeodomain-response element of the ALPL promoter.
  • Involvement in disease

    Defects in MSX2 are the cause of parietal foramina 1 (PFM1) [MIM:168500]; also known as foramina parietalia permagna (FPP). PFM1 is an autosomal dominant disease characterized by oval defects of the parietal bones caused by deficient ossification around the parietal notch, which is normally obliterated during the fifth fetal month.
    Defects in MSX2 are the cause of parietal foramina with cleidocranial dysplasia (PFMCCD) [MIM:168550]; also known as cleidocranial dysplasia with parietal foramina. PFMCCD combines skull defects in the form of enlarged parietal foramina and deficient ossification of the clavicles.
    Defects in MSX2 are the cause of craniosynostosis type 2 (CRS2) [MIM:604757]; also known as craniosynostosis Boston-type (CSB). CRS2 is an autosomal dominant disorder characterized by the premature fusion of calvarial sutures. The craniosynostosis phenotype is either fronto-orbital recession, or frontal bossing, or turribrachycephaly, or cloverleaf skull. Associated features include severe headache, high incidence of visual problems (myopia or hyperopia), and short first metatarsals. Intelligence is normal.
  • Sequence similarities

    Belongs to the Msh homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CRS 2 antibody
    • CRS2 antibody
    • FPP antibody
    • Homeo box msh like 2 antibody
    • Homeobox protein Hox-8 antibody
    • Homeobox protein MSX 2 antibody
    • Homeobox protein MSX-2 antibody
    • Homeobox protein MSX2 antibody
    • Hox 8 antibody
    • Hox8 antibody
    • MSH antibody
    • Msh homeo box 2 antibody
    • Msh homeo box homolog antibody
    • Msh homeo box homolog 2 antibody
    • Msh homeobox 2 antibody
    • Msh homeobox homolog 2 antibody
    • Msx 2 antibody
    • MSX2 antibody
    • MSX2_HUMAN antibody
    • Parietal foramina 1 antibody
    • PFM 1 antibody
    • PFM antibody
    • PFM1 antibody
    see all

Images

  • All lanes : Anti-Msx2/Hox8 antibody (ab223692) at 0.4 µg/ml

    Lane 1 : Caco-2 (human colorectal adenocarcinoma cell line) treated with control siRNA, whole cell lysate
    Lane 2 : Caco-2 treated with target-specific siRNA, whole cell lysate

    Predicted band size: 29 kDa



    Remaining relative intensity shown.

    Loading control: PPIB.

  • Formalin-fixed, paraffin-embedded human endometrium tissue stained for Msx2/Hox8 using ab223692 at 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human placenta tissue stained for Msx2/Hox8 using ab223692 at 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human urinary bladder tissue stained for Msx2/Hox8 using ab223692 at 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human endometrium tissue stained for Msx2/Hox8 using ab223692 at 1/50 dilution in immunohistochemical analysis. Low positivity, as expected.

  • Anti-Msx2/Hox8 antibody (ab223692) at 0.4 µg/ml + BEWO cell lysate

    Predicted band size: 29 kDa

  • All lanes : Anti-Msx2/Hox8 antibody (ab223692) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 29 kDa

References

This product has been referenced in:

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up