Overview

  • Product name

  • Description

    Rabbit polyclonal to MT-ND1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human MT-ND1 aa 23-67 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    TERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATST


    Database link: P03886

  • Positive control

    • Rat brain and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab218027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 36 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Involvement in disease

    Defects in MT-ND1 are a cause of Leber hereditary optic neuropathy (LHON) [MIM:535000]. LHON is a maternally inherited disease resulting in acute or subacute loss of central vision, due to optic nerve dysfunction. Cardiac conduction defects and neurological defects have also been described in some patients. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes.
    Defects in MT-ND1 are a cause of mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS) [MIM:540000]. MELAS is a genetically heterogenious disorder, characterized by episodic vomiting, seizures, and recurrent cerebral insults resembling strokes and causing hemiparesis, hemianopsia, or cortical blindness.
    Defects in MT-ND1 may be associated with susceptibility to Alzheimer disease mitochondrial (AD-MT) [MIM:502500]. Alzheimer disease is a neurodegenerative disorder characterized by progressive dementia, loss of cognitive abilities, and deposition of fibrillar amyloid proteins as intraneuronal neurofibrillary tangles, extracellular amyloid plaques and vascular amyloid deposits. The major constituent of these plaques is the neurotoxic amyloid-beta-APP 40-42 peptide (s), derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C-terminal fragments (CTFs) and the caspase-cleaved products such as C31 derived from APP, are also implicated in neuronal death.
    Defects in MT-ND1 may be associated with non-insulin-dependent diabetes mellitus (NIDDM).
  • Sequence similarities

    Belongs to the complex I subunit 1 family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Complex I, subunit ND1 antibody
    • Mitochondrially encoded NADH dehydrogenase 1 antibody
    • MT-ND1 antibody
    • MTND1 antibody
    • NAD1 antibody
    • NADH dehydrogenase subunit 1 (complex I) antibody
    • NADH dehydrogenase subunit 1 antibody
    • NADH-ubiquinone oxidoreductase chain 1 antibody
    • NADH-ubiquinone oxidoreductase, subunit ND1 antibody
    • NADH1 antibody
    • ND1 antibody
    • NU1M_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling MT-ND1 with ab218027 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded rat kidney tissue labeling MT-ND1 with ab218027 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Anti-MT-ND1 antibody (ab218027) at 1/500 dilution + Rat cerebellum tissue lysate

    Predicted band size: 36 kDa

References

ab218027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up