Overview

  • Product name

  • Description

    Rabbit polyclonal to MT-ND1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human MT-ND1 aa 23-67.
    Sequence:

    TERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATST


    Database link: P03886

  • Positive control

    • WB: Mouse heart, liver, kidney, brain, skeletal muscle and stomach lysates. IHC: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab222892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 36 kDa.

Target

  • Function

    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Involvement in disease

    Defects in MT-ND1 are a cause of Leber hereditary optic neuropathy (LHON) [MIM:535000]. LHON is a maternally inherited disease resulting in acute or subacute loss of central vision, due to optic nerve dysfunction. Cardiac conduction defects and neurological defects have also been described in some patients. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes.
    Defects in MT-ND1 are a cause of mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS) [MIM:540000]. MELAS is a genetically heterogenious disorder, characterized by episodic vomiting, seizures, and recurrent cerebral insults resembling strokes and causing hemiparesis, hemianopsia, or cortical blindness.
    Defects in MT-ND1 may be associated with susceptibility to Alzheimer disease mitochondrial (AD-MT) [MIM:502500]. Alzheimer disease is a neurodegenerative disorder characterized by progressive dementia, loss of cognitive abilities, and deposition of fibrillar amyloid proteins as intraneuronal neurofibrillary tangles, extracellular amyloid plaques and vascular amyloid deposits. The major constituent of these plaques is the neurotoxic amyloid-beta-APP 40-42 peptide (s), derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C-terminal fragments (CTFs) and the caspase-cleaved products such as C31 derived from APP, are also implicated in neuronal death.
    Defects in MT-ND1 may be associated with non-insulin-dependent diabetes mellitus (NIDDM).
  • Sequence similarities

    Belongs to the complex I subunit 1 family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Complex I, subunit ND1 antibody
    • Mitochondrially encoded NADH dehydrogenase 1 antibody
    • MT-ND1 antibody
    • MTND1 antibody
    • NAD1 antibody
    • NADH dehydrogenase subunit 1 (complex I) antibody
    • NADH dehydrogenase subunit 1 antibody
    • NADH-ubiquinone oxidoreductase chain 1 antibody
    • NADH-ubiquinone oxidoreductase, subunit ND1 antibody
    • NADH1 antibody
    • ND1 antibody
    • NU1M_HUMAN antibody
    see all

Images

  • All lanes : Anti-MT-ND1 antibody (ab222892) at 1/500 dilution

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Mouse kidney lysate
    Lane 4 : Mouse brain lysate
    Lane 5 : Mouse skeletal muscle lysate
    Lane 6 : Mouse stomach lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 36 kDa
    Observed band size: 36 kDa

  • Paraffin-embedded human kidney tissue stained for MT-ND1 using ab222892  at 1/100 dilution in immunohistochemical analysis.

References

This product has been referenced in:

  • Hou X  et al. Testosterone disruptor effect and gut microbiome perturbation in mice: Early life exposure to doxycycline. Chemosphere 222:722-731 (2019). Read more (PubMed: 30738315) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up