Overview

  • Product name

  • Description

    Rabbit polyclonal to MT-ND3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human MT-ND3 aa 40-87.
    Sequence:

    GFDPMSPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLM


    Database link: P03897

  • Positive control

    • HEK293T, RAW 264.7 and H9C2 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab192306 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 13 kDa.

Target

  • Function

    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Involvement in disease

    Defects in MT-ND3 are a cause of Leigh syndrome (LS) [MIM:256000]. LS is a severe neurological disorder characterized by bilaterally symmetrical necrotic lesions in subcortical brain regions.
    Defects in MT-ND3 are a cause of mitochondrial complex I deficiency (MT-C1D) [MIM:252010]. A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.
  • Sequence similarities

    Belongs to the complex I subunit 3 family.
  • Cellular localization

    Mitochondrion membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC=1.6.5.3 antibody
    • Mitochondrially encoded NADH dehydrogenase 3 antibody
    • MT-ND3 antibody
    • MTND3 antibody
    • NADH dehydrogenase subunit 3 antibody
    • NADH dehydrogenase, subunit 3 (complex I) antibody
    • NADH-ubiquinone oxidoreductase chain 3 antibody
    • ND3 antibody
    • NU3M_HUMAN antibody
    see all

Images

  • All lanes : Anti-MT-ND3 antibody (ab192306)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : RAW 264.7 whole cell lysate
    Lane 3 : H9C2 whole cell lysate

    Predicted band size: 13 kDa

References

ab192306 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Xenopus laevis Cell lysate - whole cell (2- 32 cell stage embryo)
Gel Running Conditions
Reduced Denaturing (4-15% gradient)
Loading amount
15 µg
Specification
2- 32 cell stage embryo
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 17°C

Abcam user community

Verified customer

Submitted Sep 11 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up