Overview

  • Product name

    Anti-MT1G antibody
  • Description

    Rabbit polyclonal to MT1G
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MT1G aa 1-59.
    Sequence:

    MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCI CKGASEKCSC


    Database link: P13640

Properties

Applications

Our Abpromise guarantee covers the use of ab193329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

Target

  • Function

    Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
  • Sequence similarities

    Belongs to the metallothionein superfamily. Type 1 family.
  • Domain

    Class I metallothioneins contain 2 metal-binding domains: four divalent ions are chelated within cluster A of the alpha domain and are coordinated via cysteinyl thiolate bridges to 11 cysteine ligands. Cluster B, the corresponding region within the beta domain, can ligate three divalent ions to 9 cysteines.
  • Information by UniProt
  • Database links

  • Alternative names

    • Metallothionein-1G antibody
    • Metallothionein-1K antibody
    • Metallothionein-IG antibody
    • MT-1G antibody
    • MT-1K antibody
    • MT-IG antibody
    • MT1G antibody
    • MT1G_HUMAN antibody
    see all

References

ab193329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
20 µg
Gel Running Conditions
Reduced Denaturing (4-12% gradient gel)
Sample
Human Cell lysate - whole cell (Normal human urothelial cells)
Specification
Normal human urothelial cells
Treatment
10 uM CdCl2 for 72 hours
Blocking step
Odyssey blocking buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 50% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Dec 15 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up