Overview

  • Product name

  • Description

    Rabbit polyclonal to MTAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human MTAP.
    Sequence:

    MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKI KNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLRE EIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTRE VLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVP EVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSL LLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH


    Database link: Q13126

  • Positive control

    • HeLa cells, HT29 and Human liver lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab196597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 31 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the PNP/MTAP phosphorylase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5' methylthioadenosine phosphorylase antibody
    • 5''-methylthioadenosine phosphorylase antibody
    • BDMF antibody
    • c86fus antibody
    • DMSFH antibody
    • DMSMFH antibody
    • Epididymis luminal protein 249 antibody
    • HEL 249 antibody
    • LGMBF antibody
    • MeSAdo phosphorylase antibody
    • Methylthioadenosine phosphorylase antibody
    • MSAP antibody
    • MTA phosphorylase antibody
    • MTAP antibody
    • MTAP_HUMAN antibody
    • MTAPase antibody
    • S methyl 5 thioadenosine phosphorylase antibody
    • S methyl 5' thioadenosine phosphorylase antibody
    • S-methyl-5''-thioadenosine phosphorylase antibody
    see all

Images

  • All lanes : Anti-MTAP antibody (ab196597) at 1/500 dilution

    Lane 1 : HT29 cell lysate
    Lane 2 : Liver cell lysate

    Predicted band size: 31 kDa

  • Immunofluorescence analysis of HeLa cells labeling MTAP (green) with ab196597 at 1/50 dilution. DAPI (blue) for nuclear staining.

References

ab196597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up