Overview

  • Product name

  • Description

    Rabbit polyclonal to MTAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Rhesus monkey
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse MTAP aa 6-275. (Expressed in E.coli).
    Sequence:

    ACTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDC VLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPG DMVIIDQFIDRTSLRPQTFYDGSHCSARGVCHIPMAEPFCPKTREVLIET AKKLGLRCHSKGTIVTIEGPRFSSRAESLIFRTWGADVVNMTTVPEVVLA KEAGICYASIAMATDYDCWKEHEEAVSVDGVLKTMKENANKAKSLLLTTI PQIGSMEWSETLRNLKNMAQ


    Database link: Q9CQ65

  • Positive control

    • WB: Mouse pancreas lysate; MCF7, HeLa and Raji cell lysate; Recombinant mouse MTAP protein. IHC-P: Mouse brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233038 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 31 kDa.

Target

  • Function

    Plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the PNP/MTAP phosphorylase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5' methylthioadenosine phosphorylase antibody
    • 5''-methylthioadenosine phosphorylase antibody
    • BDMF antibody
    • c86fus antibody
    • DMSFH antibody
    • DMSMFH antibody
    • Epididymis luminal protein 249 antibody
    • HEL 249 antibody
    • LGMBF antibody
    • MeSAdo phosphorylase antibody
    • Methylthioadenosine phosphorylase antibody
    • MSAP antibody
    • MTA phosphorylase antibody
    • MTAP antibody
    • MTAP_HUMAN antibody
    • MTAPase antibody
    • S methyl 5 thioadenosine phosphorylase antibody
    • S methyl 5' thioadenosine phosphorylase antibody
    • S-methyl-5''-thioadenosine phosphorylase antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse brain tissue stained for MTAP using ab233038 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-MTAP antibody (ab233038) at 1 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 31 kDa

  • Anti-MTAP antibody (ab233038) at 1 µg/ml + Raji (human Burkitt's lymphoma cell line) cell lysate

    Predicted band size: 31 kDa

  • Anti-MTAP antibody (ab233038) at 1 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 31 kDa

  • Anti-MTAP antibody (ab233038) at 1 µg/ml + Mouse pancreas lysate

    Predicted band size: 31 kDa

  • Anti-MTAP antibody (ab233038) at 2 µg/ml + Recombinant mouse MTAP protein

    Predicted band size: 31 kDa

References

ab233038 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up