Overview

  • Product name

  • Description

    Rabbit polyclonal to MTCH1/PSAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MTCH1/PSAP aa 100-250.
    Sequence:

    LYVKLLIQVGHEPMPPTLGTNVLGRKVLYLPSFFTYAKYIVQVDGKIGLF RGLSPRLMSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETS YEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSIGKIFKEEGL L


    Database link: Q9NZJ7

  • Positive control

    • WB: MCF7 and HepG2 whole cell lysates. IHC-P: Human liver and brain tissues.
  • General notes

     This product was previously labelled as MTCH1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 42 kDa (predicted molecular weight: 42 kDa).

Target

  • Function

    Potential mitochondrial transporter. May play a role in apoptosis.
  • Tissue specificity

    Widely expressed with a predominant expression in brain.
  • Sequence similarities

    Belongs to the mitochondrial carrier family.
    Contains 2 Solcar repeats.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cell proliferation inducing protein 60 antibody
    • CGI64 antibody
    • Mitochondrial carrier homolog 1 antibody
    • MTCH 1 antibody
    • Mtch1 antibody
    • MTCH1_HUMAN antibody
    • Presenilin associated protein antibody
    • Presenilin-associated protein antibody
    • PSAP antibody
    see all

Images

  • All lanes : Anti-MTCH1/PSAP antibody (ab230006) at 1/1000 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 42 kDa
    Observed band size: 42 kDa

  • Paraffin-embedded human liver tissue stained for MTCH1/PSAP using ab230006 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for MTCH1/PSAP using ab230006 at 1/100 dilution in immunohistochemical analysis.

References

ab230006 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230006.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up