Overview

  • Product name

    Anti-MTERFD3/MTERF2 antibody
    See all MTERFD3/MTERF2 primary antibodies
  • Description

    Rabbit polyclonal to MTERFD3/MTERF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MTERFD3/MTERF2 aa 1-200.
    Sequence:

    MLWKLLLRSQSCRLCSFRKMRSPPKYRPFLACFTYTTDKQSSKENTRTVE KLYKCSVDIRKIRRLKGWVLLEDETYVEEIANILQELGADETAVASILER CPEAIVCSPTAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQK LNVQFFQELGLKNVVISRLLTAAPNVFHNPVEKNKQMVRILQESYLDVGG


    Database link: Q49AM1

  • Positive control

    • WB: U251-MG whole cell lysate. IHC-P: Human small intestine and testis tissue.
  • General notes

     This product was previously labelled as MTERFD3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 44, 85 kDa (predicted molecular weight: 44 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Binds promoter DNA and regulates mitochondrial transcription. Required for normal levels of transcription, both for mRNA and tRNA. Required for normal mitchondrial protein synthesis, assembly of respiratory complexes and normal mitochondrial function.
  • Tissue specificity

    Expressed in skeletal muscle, heart, liver and pancreas.
  • Sequence similarities

    Belongs to the mTERF family.
  • Cellular localization

    Mitochondrion. Mitochondrion matrix > mitochondrion nucleoid.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hypothetical protein DKFZp667I1824 antibody
    • mitochondrial antibody
    • Mitochondrial transcription termination factor 2 antibody
    • Mitochondrial transcription termination factor-like protein antibody
    • MTER3_HUMAN antibody
    • MTERF domain containing 3 antibody
    • mTERF domain-containing protein 3 antibody
    • mTERF domain-containing protein 3, mitochondrial antibody
    • mTERF2 antibody
    • Mterfd3 antibody
    • mTERFL antibody
    • Transcription termination factor 2 mitochondrial antibody
    • Transcription termination factor like protein antibody
    see all

Images

  • Anti-MTERFD3/MTERF2 antibody (ab230128) at 1/1000 dilution + U251 MG (Human brain glioma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 44 kDa

  • Paraffin-embedded human small intestine tissue stained for MTERFD3/MTERF2 with ab230128 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for MTERFD3/MTERF2 with ab230128 at 1/100 dilution in immunohistochemical analysis.

References

ab230128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up