Overview

  • Product name

    Anti-MTF1 antibody [OTI2F3]
    See all MTF1 primary antibodies
  • Description

    Mouse monoclonal [OTI2F3] to MTF1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MTF1 aa 1-272. Produced in E.coli (NP_005946).
    Sequence:

    MGEHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVL IEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISP DQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRYQCTFEGCPRT YSTAGNLRTHQKTHRGEYTFVCNQEGCGKAFLTSYSLRIHVRVHTKEKPF ECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCSKYFTTLSDLRKHI RTHTGEKPFRCDHDGCGKAFAA


    Database link: Q14872

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY MTF1 cDNA for 48 hrs. IHC-P: Human kidney, liver carcinoma, lung carcinoma, ovary, ovary adenocarcinoma, prostate, prostate carcinoma and bladder carcinoma tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI2F3
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 81 kDa.
IHC-P 1/150.

Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 8.5 before commencing with IHC staining protocol.

Target

  • Function

    Activates the metallothionein I promoter. Binds to the metal responsive element (MRE).
  • Sequence similarities

    Contains 6 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Metal regulatory transcription factor 1 antibody
    • Metal response element binding transcription factor 1 antibody
    • Metal responsive transcription factor 1 antibody
    • MRE binding transcription factor antibody
    • MRE-binding transcription factor 1 antibody
    • MRE-binding transcription factor antibody
    • MTF 1 antibody
    • MTF1 antibody
    • MTF1_HUMAN antibody
    • Transcription factor MTF-1 antibody
    • Transcription factor MTF1 antibody
    • Zinc regulatory factor antibody
    • ZRF antibody
    see all

Images

  • All lanes : Anti-MTF1 antibody [OTI2F3] (ab236401) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysates transfected with pCMV6-ENTRY control cDNA for 48 hrs
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY MTF1cDNA for 48 hrs

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 81 kDa

  • Paraffin-embedded human kidney tissue stained for MTF1 using ab236401 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver carcinoma tissue stained for MTF1 using ab236401 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung carcinoma tissue stained for MTF1 using ab236401 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary tissue stained for MTF1 using ab236401 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for MTF1 using ab236401 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for MTF1 using ab236401 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate carcinoma tissue stained for MTF1 using ab236401 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder carcinoma tissue stained for MTF1 using ab236401 at 1/150 dilution in immunohistochemical analysis.

References

ab236401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up