Overview

  • Product name

  • Description

    Rabbit polyclonal to MTH1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Recombinant fragment corresponding to Human MTH1 aa 49-82.
    Sequence:

    TLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQE


    Database link: P36639

  • Positive control

    • IHC-P: Human small intestine and appendix tissue. ICC/IF: PC-3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Antimutagenic. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.
  • Tissue specificity

    Widely expressed with highest expression in thymus, testis, embryo and proliferating blood lymphocytes.
  • Sequence similarities

    Belongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Developmental stage

    In peripheral blood lymphocytes, expressed at much higher levels in proliferating cells than in resting cells.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm. Mitochondrion matrix and Cytoplasm. Mitochondrion matrix. Nucleus. Mostly present in cytoplasm. Variant Met-124 has decreased efficiency in translocation to mitochondria.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2-hydroxy-dATP diphosphatase antibody
    • 7 8 dihydro 8 oxoguanine triphosphatase antibody
    • 7 antibody
    • 8 oxo 7 8 dihydrodeoxyguanosine triphosphatase antibody
    • 8 oxo 7 8 dihydroguanosine triphosphatase antibody
    • 8 oxo dGTPase antibody
    • 8-dihydro-8-oxoguanine triphosphatase antibody
    • 8-oxo-dGTPase antibody
    • 8ODP_HUMAN antibody
    • MTH 1 antibody
    • MTH1 antibody
    • MutT human homolog 1 antibody
    • Nucleoside diphosphate linked moiety X motif 1 antibody
    • Nucleoside diphosphate linked moiety X type motif 1 antibody
    • Nucleoside diphosphate-linked moiety X motif 1 antibody
    • Nudix (nucleoside diphosphate linked moiety X) type motif 1 antibody
    • Nudix hydrolase 1 antibody
    • Nudix motif 1 antibody
    • Nudix type motif 1 antibody
    • NUDT 1 antibody
    • Nudt1 antibody
    see all

Images

  • PC-3 (Human prostate adenocarcinoma cell line) cells stained for MTH1 using ab236249 at a dilution of 1/100 in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human small intestine tissue stained for MTH1 with ab236249 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human appendix tissue stained for MTH1 with ab236249 at a 1/100 dilution in immunohistochemical analysis.

References

ab236249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up