Anti-MTHFD1L antibody (ab194466)
Key features and details
- Mouse polyclonal to MTHFD1L
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MTHFD1L antibody
See all MTHFD1L primary antibodies -
Description
Mouse polyclonal to MTHFD1L -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow
-
Immunogen
Recombinant fragment (GST-tag) corresponding to Human MTHFD1L aa 801-899. (NP_056255).
Sequence:VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAAS KRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG
Database link: Q6UB35 -
Positive control
- 293 cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: 50% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Whole antiserum -
Clonality
Polyclonal -
Isotype
IgG
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab194466 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/1000. Predicted molecular weight: 106 kDa. |
Target
-
Function
May provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2. -
Tissue specificity
Detected in most tissues, highest expression found in placenta, thymus and brain. Low expression is found in liver and skeletal muscle. Up-regulated in colon adenocarcinoma. -
Pathway
One-carbon metabolism; tetrahydrofolate interconversion. -
Sequence similarities
In the N-terminal section; belongs to the tetrahydrofolate dehydrogenase/cyclohydrolase family.
In the C-terminal section; belongs to the formate--tetrahydrofolate ligase family. -
Domain
This monofunctional enzyme consists of two major domains: an N-terminal inactive methylene-THF dehydrogenase and cyclohydrolase domain and an active larger formyl-THF synthetase C-terminal domain. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 534296 Cow
- Entrez Gene: 25902 Human
- Entrez Gene: 270685 Mouse
- Omim: 611427 Human
- SwissProt: Q0VCR7 Cow
- SwissProt: Q6UB35 Human
- SwissProt: Q3V3R1 Mouse
- Unigene: 591343 Human
see all -
Alternative names
- 10-formyl-THF synthetase antibody
- C1TM_HUMAN antibody
- Formyltetrahydrofolate synthetase antibody
see all
Images
-
Western blot - Anti-MTHFD1L antibody (ab194466)Anti-MTHFD1L antibody (ab194466) at 1/500 dilution + 293 cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 106 kDa -
Western blot - Anti-MTHFD1L antibody (ab194466)Anti-MTHFD1L antibody (ab194466) at 1/1000 dilution + recombinant Human MTHFD1L (immunogen) at 0.2 µg
Developed using the ECL technique.
Predicted band size: 106 kDaPredicted MW of immunogen: 37 KDa
Datasheets and documents
References (0)
ab194466 has not yet been referenced specifically in any publications.
