For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    By product type
    Proteins and Peptides
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Lysates
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    • Protocols & troubleshooting
    • Technical FAQs
    • Get technical help
    • RabMAb Advantages
    • Buying FAQs
    • Antibody Guide
    • Scientific webinars
    • Biochemical product FAQ
    • Support resources
    • eProcurement
    Check out our protocols

    Visit protocols and troubleshooting or check them out using the Abcam app for iPhone

    Protocols and troubleshooting

    iPhone app

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    mthfd1l-antibody-ab194466.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Share by email

Anti-MTHFD1L antibody (ab194466)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

  • Western blot - Anti-MTHFD1L antibody (ab194466)
  • Western blot - Anti-MTHFD1L antibody (ab194466)

Add compatible products

Primary

Product image

 

Secondary

Product image

 

Protein

Product image

 

Unfortunately, one or more of the products below are unavailable in your country/region.

Sorry, we can't display this right now.
Please contact us to place your order, or try again later.

View more associated products

  • Datasheet
  • References
  • Protocols

Overview

  • Product name

    Anti-MTHFD1L antibody
    See all MTHFD1L primary antibodies
  • Description

    Mouse polyclonal to MTHFD1L
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human MTHFD1L aa 801-899. (NP_056255).
    Sequence:

    VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAAS KRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG


    Database link: Q6UB35

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • 293 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 50% Glycerol
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG - Isotype Control (ab37355)
  • Recombinant Protein

    • Recombinant Human MTHFD1L protein (ab161832)
  • Related Products

    • Recombinant Human MTHFD1L protein (ab161832)

Applications

Our Abpromise guarantee covers the use of ab194466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 106 kDa.

Target

  • Function

    May provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2.
  • Tissue specificity

    Detected in most tissues, highest expression found in placenta, thymus and brain. Low expression is found in liver and skeletal muscle. Up-regulated in colon adenocarcinoma.
  • Pathway

    One-carbon metabolism; tetrahydrofolate interconversion.
  • Sequence similarities

    In the N-terminal section; belongs to the tetrahydrofolate dehydrogenase/cyclohydrolase family.
    In the C-terminal section; belongs to the formate--tetrahydrofolate ligase family.
  • Domain

    This monofunctional enzyme consists of two major domains: an N-terminal inactive methylene-THF dehydrogenase and cyclohydrolase domain and an active larger formyl-THF synthetase C-terminal domain.
  • Cellular localization

    Mitochondrion.
  • Target information above from: UniProt accession Q6UB35 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 534296 Cow
    • Entrez Gene: 25902 Human
    • Entrez Gene: 270685 Mouse
    • Omim: 611427 Human
    • SwissProt: Q0VCR7 Cow
    • SwissProt: Q6UB35 Human
    • SwissProt: Q3V3R1 Mouse
    • Unigene: 591343 Human
    • Unigene: 184752 Mouse
    see all
  • Alternative names

    • 10-formyl-THF synthetase antibody
    • C1TM_HUMAN antibody
    • Formyltetrahydrofolate synthetase antibody
    • formyltetrahydrofolate synthetase domain containing 1 antibody
    • FTHFSDC1 antibody
    • methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like antibody
    • mitochondrial antibody
    • Monofunctional C1-tetrahydrofolate synthase antibody
    • MTC1THFS antibody
    • MTHFD1L antibody
    • RP1-292B18.2 antibody
    see all

Images

  • Western blot - Anti-MTHFD1L antibody (ab194466)
    Western blot - Anti-MTHFD1L antibody (ab194466)
    Anti-MTHFD1L antibody (ab194466) at 1/500 dilution + 293 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 106 kDa

  • Western blot - Anti-MTHFD1L antibody (ab194466)
    Western blot - Anti-MTHFD1L antibody (ab194466)
    Anti-MTHFD1L antibody (ab194466) at 1/1000 dilution + recombinant Human MTHFD1L (immunogen) at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 106 kDa



    Predicted MW of immunogen: 37 KDa

Protocols

  • Western blot protocols

Datasheets and documents

    • Datasheet
  • References

    ab194466 has not yet been referenced specifically in any publications.

    Publishing research using ab194466? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab194466.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & advice
    • Buying FAQs
    • RabMAb products
    • Biochemical product FAQs
    Company
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2019 Abcam plc. All rights reserved.