Overview

  • Product name

  • Description

    Rabbit polyclonal to MTHFD1L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MTHFD1L aa 229-304.
    Sequence:

    HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIP LTWIQPGTTVLNCSHDFLSGKVGCGS


    Database link: Q6UB35

  • Positive control

    • WB: RT4 and U-252 MG whole cell lysates. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab221925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 106 kDa.

Target

  • Function

    May provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2.
  • Tissue specificity

    Detected in most tissues, highest expression found in placenta, thymus and brain. Low expression is found in liver and skeletal muscle. Up-regulated in colon adenocarcinoma.
  • Pathway

    One-carbon metabolism; tetrahydrofolate interconversion.
  • Sequence similarities

    In the N-terminal section; belongs to the tetrahydrofolate dehydrogenase/cyclohydrolase family.
    In the C-terminal section; belongs to the formate--tetrahydrofolate ligase family.
  • Domain

    This monofunctional enzyme consists of two major domains: an N-terminal inactive methylene-THF dehydrogenase and cyclohydrolase domain and an active larger formyl-THF synthetase C-terminal domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 10-formyl-THF synthetase antibody
    • C1TM_HUMAN antibody
    • Formyltetrahydrofolate synthetase antibody
    • formyltetrahydrofolate synthetase domain containing 1 antibody
    • FTHFSDC1 antibody
    • methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like antibody
    • mitochondrial antibody
    • Monofunctional C1-tetrahydrofolate synthase antibody
    • MTC1THFS antibody
    • MTHFD1L antibody
    • RP1-292B18.2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for MTHFD1L (green) using ab221925 (4 µg/ml) in ICC/IF.

  • All lanes : Anti-MTHFD1L antibody (ab221925) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate

    Predicted band size: 106 kDa

References

ab221925 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up